Entry information : AtPrx07 (At1g30870 / PER7 / AtP30)
Entry ID 83
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-10 (Achraf Jemmat)
Peroxidase information: AtPrx07 (At1g30870 / PER7 / AtP30)
Name (synonym) AtPrx07 (At1g30870 / PER7 / AtP30)
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx07
start..stop
S start..stop
AlyPrx07 619 0 18..349 18..349
BstrPrx10 605 0 17..349 17..351
AhalPrx54 596 0 43..349 1..307
CrubPrx42 595 0 17..349 16..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10991535..10991822 288 N° 2 10992124..10992885 762  
join(10991535..10991822,10992124..10992885)


exon

Literature and cross-references AtPrx07 (At1g30870 / PER7 / AtP30)
Protein ref. UniProtKB:   Q9SY33
DNA ref. Phytozome 12:   Chr1 (10991535..10992885)
mRNA ref. GenBank:   NM_102824
Cluster/Prediction ref. Phytozome Gene 12:   19654292 UniGene:   At.27629
Omic ref. AtProteome:   At1g30870 ATTED-II:   At1g30870 e-FP Browser:   At1g30870 ePlant:   At1g30870 Genevestigator:   At1g30870 TAIR:   At1g30870
Protein sequence: AtPrx07 (At1g30870 / PER7 / AtP30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (327)
PWM (Da):   %s   38152.42 (35921.1) Transmb domain:   %s   i5-22o
PI (pH):   %s   6.89 (6.51) Peptide Signal:   %s   cut: 23 range:23-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLAVVSVVVILGVLVAWPVSAGRKDLPGAGGYGGDDDDDTKSLFPLDNLLSLNYYDRICPDFEKIVVTKVREWTKSDSSLGPALLRLIFHDCGVTGCDASVLLDYEGTERRSPASKTLRGFELIDDIKSEMEKSCPGKVSCADILTSASRAATVQLGGPYWPNVYGRRDSKHSYARDVEKVPSGRRDVTALLETFQSYGLNVLDLVVLSGAHTIGKASCGTIQSRLYNYNATSGSDPSIDAKYADYLQRRCRWASETVDLDPVTPAVFDNQYYINLQKHMGVLSTDQELVKDPRTAPLVKTFAEQSPQIFRQQFAVSMAKLVNVGVLTGEDRVGEIRKVCSKSNSRAY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1), 3 cDNA and 13 ESTs (only from roots).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTTAAGAGT CCTAAAATGG CTCTGTTTTG TCCCTTAAAC TGGGGAACGT GTCTGTAAAA CAAGGCAATA AAGAATGAGG TGTAAGAATA CAGAGAAAGA AAAGCCTTAT GTGGCCAAAA  GTGATAAATT GTTATAGAAA AATAAAAAAG CTACTTATAA TTTTGGACAA AATTGAATTT GAAAGATATT GTATAACACA TGTCATTATA CTGGTAAAAG CATTTAATTG TGTAATGCAT  GAAAAAATTA ACATTGGATT GTTATACTAA TTAAAGGGTG ATTAAATTAT TTAATAATTA AGGCTCCTAA ATATGCTAGA GTCAAAAAGG AGCCGTTGAG GAATTTAGCC GTTGTCGAGT  GGGAACCATG CACTTTCTGG ATTTTATGCC ACATCATAAA TCAAATTGAA GAACTAAAGA TAACAAACAA TTTTAAATTG TATAACTGAC AGGAACAAAA ACTTTTAAGC AAAGTAAAAA  TAATTTAATT AGAGAAAATT AGATGTTCAA CCCAAGTTTC ATGTAGTGTG CGATTTTATT GTAGTGTGGT CAATAGGCCC AGGCATAGTG GTCAATGTCG TGCTTGGGTT AGTCGAATAG  AGAGAGAACT TAGGACGAGT TGTGATTTGT GACTCTTATA AAACGATTTA AGAAAAAATA GTCTCTATAC AAAATAACGA TAATTGAAAC CAATAATAAG GTTCACAACC GATCATTTTC  GGATCCCGAT GAGTTAACGA TTAGTCAACG ATAGAGTAAA ACGACCGATT AATCGAGACT TAGTGTCTAT GATATTGGCA CATACGACAT ATATTTCGTA TATATATTTC AGGTAACTGG  GTATCGTTTA TATTAGTTGC GGCATATGTG ATAATGTATT CTTCCACACT TCGTATAGCT AGCTGACAAT CTTTTTTCTT AAAGTTTAAG TATTAGGAAG TATTATCCGG TAGATAAAGA  AGATGGACGA TTGAAAAAGC GATTGATACG ATTTTTCTTC TGTGATTTTT CCGACCGGCC GGCGTTGGTT CCGACTTCGA TTGTACTCTT TTCTCCTTTA TAATTCTAGC AAATATTAGT  TTACATACAT ATATTTCAGT TATTAACAAT GAGTTCTAGA GAATCAACTG CTTTTGGTTG GCCTCTTTTC ACACTGTTGG CGATTTTCAT GACCCAAAAA TTGAGTTTTC TACAATTATT  TGTAAGAAAT ATAAATTATA AAAACTAGAA AAATATATGA AAAAGTTTAA GGTTTTGACT AGTGAGAATT TGTTGTATAG TTCAAAAAAA CTCAAAATTT GAACGTTTGA AAACTTGTTG  AGATGCATCA ATTTTCAATA AACGTAGCCT ATGGTGAATT GTTTTTTTTT TTTTGTCAAC ATGTCTCTAA TGGACCTATT TTTCCGTGCT AAAAAATGTG CAGAGGTAAT ATCGCTATTT  TTGTTAGAGG ATCTGAGCAA ATTCATTATT AATGATTGTG CAAAAAATTT GTTAATTTCG ATATATCACA TTTTGCTTTA CGGATTACTC GAAAACATAC TTTGATGTCA TCATCCAGTG  TATATATACG TATGTTAATT GTAGACAACA AAATAAAATA ATAATAGTCT CACATAACCG ACCAAAAAAC AAACAAAATT AAATCAATGG AAGTTGTTGA CAAATAAATT TTACAATTAA  TCTAATCCAA ATAAGTCAAA ACCCTGATTT CAGTAATGTA AAGATCATTA TATCATTTTT TCTCTTGTAA AAAGGTTTTT TAAAATTATA CTATTAATAT ATATCATTTG ATCAAAAAAA  AATTATATAT CATAAACATT ATATACGACA TGCAGGCAAG TCACTCGAAT ATTCAAATCT TAAAGTTGTG CCTCCCACGT AAAAGCATCA CATTAGTTTC CAAACCCAAT TGTATATATA 
AATTACTACA CAACACACCT CTCATCAAAC AAATTCATCA AAGCCAATCA AATTGAGAGA GATATCAAGA AAGCAAAATA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTATAATCA TCATCCCTCA TGAGAAGGAT CTTTTGTTTC TTGAAATAAT TTCTTGTTTG GTTTTTGAGC TCTTTTCTAT TGCAATTTTG TAATTTGTTG TATGAACAAG AACAAAAACT  GTGAATTATT TTCGTTGCAA CTTCGATTTA CATGAGTTCT ACACTTACCG TCACTATTTG ATCAAGACAA TACTTAATAT CAGTCCAACA TGATCAATTT ATGTCAAAGG GTTCATGATG  TTAATGGTAA TAACCCTAAA CGTTAACTCT AAATCAAGTT GTGATGATAG CTTTTGGTGC AAGAAAAATG AAAGATGGGA GACACAATTC AGACGCGATC ACGTTTTTAG GGTTTCTATA  GTACTGAAAC TCATGGAAAA AACACAGTAC AAAAGATGCT ATATTCTAAG ACATTGAAGA ACCCCAAAAT TAAGAGAGAA CATAAATTAT GCAAGTAGAA AACAAACCCA GTAGAAGAAA  GCCAAGACCA GTTTTAGTTT CGTTTGCCTC GAAGGACACC CTTACTACGA CGATTCTTCA TCCCCAGCTT AAACTTCTTC TTCAACTTCT TCCCAATAGG TTTTAGCGAC TTGTTTTTCT  TCTCATCATC CATTTCCTCA TCTACAAGCA AACAACAATA GTATCCCAAA ACAGAACAAA CCCTTAATAC CAAAACTTTC AAAGATATAC TTGTAGATGC ACACAAAATT CAATATAAAG  AAACCAAACA AAGCTTTTAG AGCGATACGT TTCTCTTAGA GTAACAACCT TCCCAAGAGT AATGAACTAA CAAGCTCCTT CAAAGATTTC AACTAAAATG AATGATTCAG TTAAATTTCA  GATTCTAAAG CTTAGCTTAA ATTCGATTCT TCAAGCGTTA CCTTATCTAA AACCAAATCG TACAAAATCA AAGAGGCAAA TTTAGAGGAG GCATACCACT ATCGTTGGCG ATTGTAGTGG 
AGGCAGATGC AGACTCAGAG GAAGGCGTCG CAACTTCCAT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTGGCCGTGGTCTCAGTCGTTGTCATACTCGGAGTTCTCGTGGCTTGGCCGGTATCGGCTGGCCGAAAAGACTTACCTGGAGCGGGAGGATACGGAGGCGATGACGATGATGAT
ACAAAGTCATTGTTCCCTTTGGACAACCTATTATCGTTGAATTATTATGATAGGATTTGTCCAGATTTTGAGAAAATCGTTGTTACGAAAGTGAGGGAATGGACTAAGAGTGACTCTTCC
CTTGGTCCCGCCCTCCTCCGCCTTATCTTCCACGATTGTGGCGTCACG
GTATTGCAATTAATCGTTCAATTATATATAGCCAATGTTTTGATTCATATATGATTTACATTGTTCTAAAAA
TGGGTTTCACTATTACTCTATTAGAGATTAGAATTGTTCTTCCGTCTATCTAGACCATACTTGGAACATTGATAGTATATAGATATAAGTTTCTTAATATTGAAGACGGACTTGCGCACT
TTATTCTGTGTATAAACGCATCTGAGTGTTTTGCGCATATCTAATATAGTTATGCATTTTAAAAGATAACAACTTGACATTTTTGTACATGAATTAACACAACTTTCAGGGATGTGATGC
GTCTGTTCTTCTAGACTACGAAGGGACAGAGAGAAGATCTCCGGCTAGCAAAACACTAAGAGGCTTCGAGCTAATTGACGATATCAAGTCCGAGATGGAGAAATCATGCCCCGGCAAAGT
ATCCTGCGCCGACATCCTAACATCAGCCAGCCGTGCCGCCACCGTCCAACTTGGTGGTCCTTACTGGCCCAACGTCTACGGTCGTCGTGACTCCAAACACTCTTACGCTAGAGACGTAGA
GAAAGTCCCTTCAGGCCGTCGTGATGTTACCGCCCTTCTCGAAACGTTTCAGTCATACGGTCTCAACGTCCTCGACCTAGTTGTCCTTTCCGGGGCCCACACCATCGGAAAAGCGTCCTG
TGGCACCATCCAGTCGAGGCTTTACAACTACAACGCAACCAGTGGTTCAGATCCTTCGATTGACGCAAAATACGCTGATTACTTGCAACGCAGGTGTCGCTGGGCCTCTGAGACCGTCGA
TCTCGACCCTGTAACTCCAGCAGTGTTCGATAATCAGTACTACATTAATCTTCAGAAGCATATGGGAGTTTTGTCGACTGATCAGGAGCTTGTTAAGGACCCAAGGACTGCTCCGCTTGT
AAAGACTTTCGCAGAGCAATCACCTCAGATATTCAGACAGCAGTTTGCTGTGTCCATGGCTAAGCTGGTCAACGTTGGAGTTCTCACTGGTGAAGATCGTGTCGGAGAGATCAGGAAGGT
TTGCAGCAAATCTAACTCCAGAGCTTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTTGGCCGTGGTCTCAGTCGTTGTCATACTCGGAGTTCTCGTGGCTTGGCCGGTATCGGCTGGCCGAAAAGACTTACCTGGAGCGGGAGGATACGGAGGCGATGACGATGATGAT
ACAAAGTCATTGTTCCCTTTGGACAACCTATTATCGTTGAATTATTATGATAGGATTTGTCCAGATTTTGAGAAAATCGTTGTTACGAAAGTGAGGGAATGGACTAAGAGTGACTCTTCC
CTTGGTCCCGCCCTCCTCCGCCTTATCTTCCACGATTGTGGCGTCACG
GGATGTGATGCGTCTGTTCTTCTAGACTACGAAGGGACAGAGAGAAGATCTCCGGCTAGCAAAACACTAAGA
GGCTTCGAGCTAATTGACGATATCAAGTCCGAGATGGAGAAATCATGCCCCGGCAAAGTATCCTGCGCCGACATCCTAACATCAGCCAGCCGTGCCGCCACCGTCCAACTTGGTGGTCCT
TACTGGCCCAACGTCTACGGTCGTCGTGACTCCAAACACTCTTACGCTAGAGACGTAGAGAAAGTCCCTTCAGGCCGTCGTGATGTTACCGCCCTTCTCGAAACGTTTCAGTCATACGGT
CTCAACGTCCTCGACCTAGTTGTCCTTTCCGGGGCCCACACCATCGGAAAAGCGTCCTGTGGCACCATCCAGTCGAGGCTTTACAACTACAACGCAACCAGTGGTTCAGATCCTTCGATT
GACGCAAAATACGCTGATTACTTGCAACGCAGGTGTCGCTGGGCCTCTGAGACCGTCGATCTCGACCCTGTAACTCCAGCAGTGTTCGATAATCAGTACTACATTAATCTTCAGAAGCAT
ATGGGAGTTTTGTCGACTGATCAGGAGCTTGTTAAGGACCCAAGGACTGCTCCGCTTGTAAAGACTTTCGCAGAGCAATCACCTCAGATATTCAGACAGCAGTTTGCTGTGTCCATGGCT
AAGCTGGTCAACGTTGGAGTTCTCACTGGTGAAGATCGTGTCGGAGAGATCAGGAAGGTTTGCAGCAAATCTAACTCCAGAGCTTACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAATTCATCA AAGCCAATCA AATTGAGAGA GATATCAAGA AAGCAAAATA ATGAAGTTGG CCGTGGTCTC AGTCGTTGTC ATACTCGGAG TTCTCGTGGC TTGGCCGGTA TCGGCTGGCC  GAAAAGACTT ACCTGGAGCG GGAGGATACG GAGGCGATGA CGATGATGAT ACAAAGTCAT TGTTCCCTTT GGACAACCTA TTATCGTTGA ATTATTATGA TAGGATTTGT CCAGATTTTG  AGAAAATCGT TGTTACGAAA GTGAGGGAAT GGACTAAGAG TGACTCTTCC CTTGGTCCCG CCCTCCTCCG CCTTATCTTC CACGATTGTG GCGTCACGGG ATGTGATGCG TCTGTTCTTC  TAGACTACGA AGGGACAGAG AGAAGATCTC CGGCTAGCAA AACACTAAGA GGCTTCGAGC TAATTGACGA TATCAAGTCC GAGATGGAGA AATCATGCCC CGGCAAAGTA TCCTGCGCCG  ACATCCTAAC ATCAGCCAGC CGTGCCGCCA CCGTCCAACT TGGTGGTCCT TACTGGCCCA ACGTCTACGG TCGTCGTGAC TCCAAACACT CTTACGCTAG AGACGTAGAG AAAGTCCCTT  CAGGCCGTCG TGATGTTACC GCCCTTCTCG AAACGTTTCA GTCATACGGT CTCAACGTCC TCGACCTAGT TGTCCTTTCC GGGGCCCACA CCATCGGAAA AGCGTCCTGT GGCACCATCC  AGTCGAGGCT TTACAACTAC AACGCAACCA GTGGTTCAGA TCCTTCGATT GACGCAAAAT ACGCTGATTA CTTGCAACGC AGGTGTCGCT GGGCCTCTGA GACCGTCGAT CTCGACCCTG  TAACTCCAGC AGTGTTCGAT AATCAGTACT ACATTAATCT TCAGAAGCAT ATGGGAGTTT TGTCGACTGA TCAGGAGCTT GTTAAGGACC CAAGGACTGC TCCGCTTGTA AAGACTTTCG  CAGAGCAATC ACCTCAGATA TTCAGACAGC AGTTTGCTGT GTCCATGGCT AAGCTGGTCA ACGTTGGAGT TCTCACTGGT GAAGATCGTG TCGGAGAGAT CAGGAAGGTT TGCAGCAAAT  CTAACTCCAG AGCTTACTAA ATTATAATCA TCATCCCTCA TGAGAAGGAT CTTTTGTTTC TTGAAATAAT TTCTTGTTTG GTTTTTGAGC TCTTTTCTAT TGCAATTTTG TAATTTGTTG 
TATGAACAAG AACAAAAACT GTGAATTATT TTCGTTGC 

Retrieve as FASTA