Entry information : VcaAPx-R (62034)
Entry ID 8357
Creation 2011-05-02 (Christophe Dunand)
Last sequence changes 2011-11-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: VcaAPx-R (62034)
Name (synonym) VcaAPx-R (62034)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Chlorophyta Chlorophyceae Volvocaceae Volvox
Organism Volvox carteri    [TaxId: 3067 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VcaAPx-R
start..stop
S start..stop
CreAPx-R 346 1e-119 83..324 93..337
BoAPx-R-1Ca_other 249 2e-81 94..319 96..319
CsorAPx-R 248 3e-81 102..324 98..319
TsAPx-R 248 4e-81 60..319 65..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 873628..873715 88 N° 2 874070..874299 230 N° 3 875162..875308 147 N° 4 875850..876069 220
N° 5 876625..876893 269  
join(873628..873715,874070..874299,875162..875308,875850..876069,876625..876893)


exon

Literature and cross-references VcaAPx-R (62034)
DNA ref. Phytozome 12:   scaffold_27 (873628..876893)
Protein sequence: VcaAPx-R (62034)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326
PWM (Da):   %s   34565.86  
PI (pH):   %s   7.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKYVHLICKIKCELLHRVFVGVPSLLCDGCHDRDQTKEQPALSRRQVLGLSAPLLGALIGGVLPSIGQLVATAPATAAAISVPVTPSREVKAALNKALARAIPKAKTAVALRLVFHDAGTFSFPPGNGGLNASIQYELDRPENAGLKRGWRIIEQVRVCMFVCGVATDADLVALAGAYAVRLCGGPDIALALGRPVAAAASPDPPDRMPGENFTAEQLKANFAAKGLSVQEMVALSGAHTLGSKGFGDPTRFDNEYYRALLRRPWTNPNDSMASMIGLPSDHVLPDDPECLPYIERYAEDQDAFFADFAAAYVKLTSLGVPGWAV*

Retrieve as FASTA  
Remarks Complete sequence from DNA (4 introns). Incorrect prediction from Phytozome (first exon is missing). Problem to predict the 5'end. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATATGTTCACCTGATCTGCAAAATAAAATGCGAATTGCTGCACAGAGTGTTTGTTGGCGTTCCGTCACTGCTGTGCGATGGTTGTCAGTCTGATCAGACCCCGTATGCCCCGTAC
TCGACTCTCCTTTCGGGAACTCTCAAGTTCCCGCGTCGCATTTCACTTCAATTTTGGATAGCCCGATCCGTGCACTGTCACACTCATTAGCTATGTTTGGCGTTCTGCATCGCCCACCGT
GCCCCGATACTCTCGCCAGCCGAACACCTGGCGCGAAACAACGCAATCCTCTTCTGATTAGAGCGGATGTAGCGCATCAGGCCCGCGTCCCATCGACAGGTCAGGTCCCAGTCAGCTCTT
GCAATCTCGTCGCGAGGAGCCGGACAGTCATCGAAATGGTCCGGTCAGCAACACGCTCCCCATCGCGGTCTTTTGCACGCAGGCCATGACCGGGATCAGACTAAAGAGCAGCCAGCTCTT
TCCAGGCGCCAGGTACTGGGTCTTTCTGCGCCGCTGCTGGGCGCATTAATTGGTGGAGTGCTGCCGTCCATTGGCCAGCTGGTCGCCACAGCCCCCGCCACCGCCGCTGCTATTTCTGTC
CCAGTTACTCCCTCCAGGGAAGTCAAGGCAGCCCTCAACAAGGCGCTAGCCCGGGCCATCCCCAAGGCCAAG
GTGGGTGGGCCAAGTAGGCACGAACGATTGAAAGGAGGGAGACGCCGC
ACAGACCGAGAACGTGGGCGGGGATTGGAGGTAACGGCCTGAAATTCAAACTGCGTTTCGGTGCGAGGCGGGTAATCCGAGGTAATGCGATATGTCAATAAAGCAACAGCCAGGTGTGGC
TTAGGAAGGAAGGATGCCCCAGCTTTTCAACCCACGACACACGACATGAGAGGAGGGCGGGGGAAAGAGAGGGTGGGGTGAAGTGGGAGAGATAGATAGGAAGGAGAGCTGCAGTCCTTC
CAGGCCTCTCATCCTGGTTACCCTGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCCCACAGCAACCACTGATGTGTACGGGTATGGAGCTGCGGTG
GGGCGAGGACATGGCCACACCCCTCCCTCCAGTCTTCCGTTCATCCAGTCCTCCACCTCCCTGCGCCCACCGACCTCCGCCCCAAGTGCCCCATCCCCGGGGGTGGGTGGGTACCTAGTG
CGCAGTGCCCCCCCCTGTGCACCGGGGTACTGGCGTACGGCTTACCCGGCTGCTACGGACTGACGATAGGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
TCGTCATGTTCATCTGCCATCCCGGGCCCCACCACCCCTAACCCCGCCACCGGCACTCTTGGGCCTCGACGGCGTCCGCCCCACCGCATCACCGCTTCAGCCCCGCAATGTGTCGTATGC
GTGCGTGCGGGCTTCGTCGTCACGGCTGAATGCGTCTTACTTTCCTTGCCTCCCCCCCCCCACCTCACCCGCATGCACATACACATACGTACAGACGGCCGTGGCGCTGCGACTTGTGTT
TCACGACGCGGGCACCTTCAGCTTTCCCCCGGGGAACGGGGGGCTGAACGCCTCCATACAGTACGAACTGGACCGCCCTGAAAATGCGGGGCTGAAGAGGGGGTGGAGGATCATAGAGCA
G
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTGTTTGGGGTAAGGCAAGGGAGGGGAAGGACAGTCCCAGCAGGGTAACCCCCTGTCCGGGTGCGTGTGGCGGCGTGGGTGC
GCCTGGCACCCGCCCCTAGGGGGTGGGACTTCATCCATCCTCGAATGCAATGGCACGGCGACTATGCGGTGGTGGTTCGTATGTGGCTGAGCTGGCTCAGGGTTATTTCCTTAGACCCCA
ACAACCCACCAATACACAATTNNNNNNNNNNNNNNNNNNNNNNNNTTCCTTCCCCCTTCACGTAGGGTCTCGCTCTGTTTGGGGCTCATTACGTATCTCATATGCCCACCAACTGATGTG
TATGTTCCCCCTGTCTATCTATCTATCTATCCGTCAGGCCCATTCTTCCTCTCCCCCCGCGGCATCACTTCCTCAACCCCTCACGTCCCCGCCCGAANNNNNNNNNNNNNNNNNNNNNNN
NNNNNNTCCCCCTCCCCGGCCCCCCTCAGGTCCGTGATGAGCTGCGGGGTACCCCCGCCGAGGGTGTTGCGACGGATGCGGACCTGGTGGCTCTAGCTGGGGCTTATGCGGTGCGGCTGT
GTGGGGGCCCGGACATCGCTCTGGCGCTGGGCAGGCCGGTGGCGGCGGCGGCCTCCCCCGACCCCCCGGACCGCATGCCCGGAGAGAACTTCACCGCGGAGCAGCTCAAGGCCAACTTCG
CGGCCAAGGGGCTGAGCGTGCAGGAGATGGTGGCGCTGTCGG
GTAGGGGGGGGGTAGGGAGCGGTTGGGATGAGGGAAGGAGGAGGGAGGGGGTAAGCTAAGCGGGGTTTTTCGCTGTGT
TCGGCCCCCCTTTGGGCCCCCCTCTTGCGCTTCCCGTTCCAGTTGTAGCTTTTAGGCCTTTACTGTCCCTTTCCCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCATGGCATGG
TTACTACATAACACCAGCATCTTTTGAGAACAGGACCGCGGGCTTTACGGGCCCGTTGCGCGACCGACTCTGCCCCCCTCCTCCTACAATTCCCTCCTCGGCCCCCTGGCCAACGGGACG
AGCCCCCGGGGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAAAAGTGTCATCATATTTTAATGGCTTTCCCTTGTATGTATATTGGTCGTATTTGCTTCTC
CTAACTCTCCCTTTTTTCCTCGCGCCCAACACCCGCCGGCCACGAGGGAACCCCAATCCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGCAGGTG
CCCACACGCTAGGCAGCAAGGGCTTTGGGGACCCCACCCGCTTCGACAACGAGTACTACCGGGCCCTGCTTCGCCGCCCCTGGACCAATCCCAACGACTCGATGGCCTCCATGATCGGCC
TGCCCTCGGATCATGTACTGCCGGATGACCCGGAGTGCCTGCCGTATATCGAGCGTTACGCGGAGGACCAGGACGCTTTCTTTGCGGACTTCGCGGCGGCGTACGTCAAGTTGACGAGCT
TGGGGGTCCCGGGGTGGGCGGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATATGTTCACCTGATCTGCAAAATAAAATGCGAATTGCTGCACAGAGTGTTTGTTGGCGTTCCGTCACTGCTGTGCGATGGTTGCCATGACCGGGATCAGACTAAAGAGCAGCCA
GCTCTTTCCAGGCGCCAGGTACTGGGTCTTTCTGCGCCGCTGCTGGGCGCATTAATTGGTGGAGTGCTGCCGTCCATTGGCCAGCTGGTCGCCACAGCCCCCGCCACCGCCGCTGCTATT
TCTGTCCCAGTTACTCCCTCCAGGGAAGTCAAGGCAGCCCTCAACAAGGCGCTAGCCCGGGCCATCCCCAAGGCCAAG
ACGGCCGTGGCGCTGCGACTTGTGTTTCACGACGCGGGCACC
TTCAGCTTTCCCCCGGGGAACGGGGGGCTGAACGCCTCCATACAGTACGAACTGGACCGCCCTGAAAATGCGGGGCTGAAGAGGGGGTGGAGGATCATAGAGCAG
GGTGTTGCGACGGAT
GCGGACCTGGTGGCTCTAGCTGGGGCTTATGCGGTGCGGCTGTGTGGGGGCCCGGACATCGCTCTGGCGCTGGGCAGGCCGGTGGCGGCGGCGGCCTCCCCCGACCCCCCGGACCGCATG
CCCGGAGAGAACTTCACCGCGGAGCAGCTCAAGGCCAACTTCGCGGCCAAGGGGCTGAGCGTGCAGGAGATGGTGGCGCTGTCGG
GTGCCCACACGCTAGGCAGCAAGGGCTTTGGGGAC
CCCACCCGCTTCGACAACGAGTACTACCGGGCCCTGCTTCGCCGCCCCTGGACCAATCCCAACGACTCGATGGCCTCCATGATCGGCCTGCCCTCGGATCATGTACTGCCGGATGACCCG
GAGTGCCTGCCGTATATCGAGCGTTACGCGGAGGACCAGGACGCTTTCTTTGCGGACTTCGCGGCGGCGTACGTCAAGTTGACGAGCTTGGGGGTCCCGGGGTGGGCGGTGTGA

Retrieve as FASTA