Entry information : CsAPx-R (orange1.1g019824m)
Entry ID 8367
Creation 2011-05-09 (Christophe Dunand)
Last sequence changes 2011-05-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsAPx-R (orange1.1g019824m)
Name (synonym) CsAPx-R (orange1.1g019824m)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsAPx-R
start..stop
S start..stop
CclAPx-R 684 0 1..335 1..335
GhAPx-R 468 5e-167 25..334 23..333
PtAPx-R 466 1e-166 27..335 27..337
GrAPx-R 464 4e-166 25..335 23..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 477497..477674 178 N° 2 477296..477410 115 N° 3 476462..476589 128 N° 4 476315..476385 71
N° 5 476119..476161 43 N° 6 475937..476033 97 N° 7 475626..475709 84 N° 8 475218..475339 122
N° 9 474948..475014 67 N° 10 474650..474752 103  
complement(join(474650..474752,474948..475014,475218..475339,475626..475709,4759 37..476033,476119..476161,476315..476385,476462..476589,477296..477410,477497..4 77674))


exon

Literature and cross-references CsAPx-R (orange1.1g019824m)
DNA ref. Phytozome 12:   scaffold00051 (477674..474650)
EST ref. GenBank:   EY742006.1 [Fragment]
Protein sequence: CsAPx-R (orange1.1g019824m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335
PWM (Da):   %s   36331.29  
PI (pH):   %s   8.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSTASSLCGCSTAYYSSPLLAPKFKFKFPAKSQRSSLSTVEFRANPLTISSSLVNHRGKDGSCNSNRRRRGLLLTATLPFLLPLHEFVQDLGAKAESGMSDYLLMKEEVTKVVSKGKAASVLRLAFHDAGTFEMDDNGGMNGSIVYELERPENAGLNKPLILEKAKGDVNAIRPVSWADMIALGGAVAVSVCGGPNIPVPMGRLDSMEPDPEGKLPQETLDASGLKQCFQRKGFSAQELVALSGAHTLGTKGFGNPIVFDNSYYKILLEKPWQSAGMSSMIGLPSDRALVEDDECLRWIKMYADNQNMFFEDFKNAYVKLVNSGARWRSL

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTCATCAACTGCCTCCAGCCTCTGCGGCTGCTCCACCGCTTACTACTCTTCCCCTCTCCTCGCTCCCAAATTTAAATTCAAGTTTCCCGCCAAATCACAACGGTCCTCTCTCTCA
ACGGTCGAATTTCGCGCCAATCCCCTCACAATTTCTTCCTCCTTAGTCAACCACCGAG
GTTCCAGTGACTGACCATAAAACTGATTCTTGTGATTAATTCTTAATTTATGTATTTTAACT
CTTTACATATGTTTAAATTTACAGGGAAAGATGGATCTTGCAATTCGAATAGGAGGAGGAGAGGACTGTTGCTTACGGCTACACTTCCATTTCTTCTTCCTCTCCACGAATTTGTGCAAG
ACCTGGGCGCAAAAGCTGA
GTAAGTTGATTTTTTCTTTTTTTCTTTTTTTCCAAAAGCTGTAATTGTCTGATTTTGGATGCAACTTTCATTTTGTTCATTTAAGATTGTAATTAAATCAT
CTAATTGGATATAATTGAATAGCATACGTCTCTCCAATATTGTCATGTTTCATACATGAGCTTTGTTTTCATATACGATATTGCCATGCTTCAAAAGTTGGCGCACAACTTTTTTCTTTT
TCCTCACCTAATGTCGCGTATGACATGACATTGTTAGTTGTTACAATTTGCTTGGTCTTATGTGATCATTTTATCTTACCATCTCACCGATACATGGTGAATTGTTTGATTTTGATGGCC
ATATGTATGTGAAATCATTTGAGATACTATATTTGTATGCCAACTTTGTAAGTGTAGCATTACTCACATACAAGCCTTCAATAGTGCCCGTGTCCTAAAGCTTGGATAAAAGGTTTAATC
CACATATTTTGCTAAACAGAATTACTAGTTAACAAATATAATACAGAGAGTGTGGGTTGCTAAACATTATCTTCCAAGTAAAAGTTTAGTGGCTTTTGGAGGCCAGTAGTTACAAACATA
TCCCCATTTGAGTTCTGAGGTAACTGGCCAAGTGTTAATAGTTTCTCTGTGTTGCTTGACTAGATCCTGCAATTTTTTTTTCCGTTTTTCTGATTATTTTTCAATTTCCTTTACTGACAC
CACAGGTCAGGTATGAGTGACTATCTGCTTATGAAAGAAGAAGTGACTAAGGTAGTTTCAAAAGGCAAGGCTGCTAGTGTACTTCGTCTTGCATTTCATGATGCAGGGACCTTTGAAATG
GATGATAATTCGG
GTAAGTTTTAGGATATTATGATTGGTCTTCCTCAGTTTCCCATAAAATTTATCATGTCTTCTTGTCATTAGTGCAGGTGGTATGAACGGTTCTATAGTTTATGAACT
GGAAAGACCTGAAAATGCAGGCCTGAACAAGCCTTTGAAG
GCATGCTCTGTTTCCTTTGTTTTGTTATTGTTTTGATATATGTACTTTGTTTTCTAATTATCCATCCCTTAGATTCCTTG
AACATAAGTCCAAACAAATTAACTCTTATGTCGCTCTACCAGCTAACCCTTTACTGGATCCATTGTTGTTTAGATTCTAGAGAAAGCAAAGGGTGACGTGAATGCAATACGGCCAGGTTT
GTCCATCTGAAATTCTGCTGTTGAATCTCTGATAGCTACGTATGCTATGGTGCTAAGATGTGTGAATCTTGCATTGTTTAGTGTCATGGGCAGATATGATCGCTTTGGGTGGAGCTGTAG
CAGTTTCAGTTTGCGGAGGTCCAAACATCCCAGTTCCTATGGGCAGACTTGATTCAAT
GTAAGTAGCTAGCTTTCCACTAAGATTATTAACTTTAAATAGAATCAATTAGGCAAACAAAG
ATTATTTACCAGAGGGATCCTCAAATGTGCAATTTCATCAATATTAAATCTTATGTGCTTCAGTGCTGATTCATTTGGAAAATTGATCAAATATCATATCATTTCATACGATAACTATCC
GAGCCTTCACTGTTTTTGCTTTTAATAAGGGATTTTTCTTCATAGGGAGCCTGATCCTGAAGGAAAACTTCCGCAAGAAACTTTGGATGCTTCTGGTTTGAAGCAATGCTTTCAAAGAAA
AGGCTTCTC
GTGAGTTTATACCAGCAGACATATTTTTTATCCATATTTTCTTCTCTAATTAAGTTCAGTAATCTGTTGAGTGAATTCCTTATAAAACTAAAATCTAGCTGGCCATTTTTA
TCATTTTTTTAAATTATGAAAATCAGTAATATGCATGCTTATAAGGCATTTAGCCACAATCTAGTTGGTACTACATTCATGTTGTTGGAAAAGCATTAACATACAGTAATTCCAATTCAG
GAACATCTGGATTGAGGAAAACCATGGCTTTTATTTATTTTATTTTTATTTTCAGAGCACAAGAGCTAGTTGCTTTATCTGGAGCCCATACTCTTGGAACCAAAGGTTTTGGAAATCCAA
TAGTTTTCGACAATTCGTACTATAAAATTCTTTTAGAGAAGCCATGGCAGTCTTCAG
GTGAATAGCCTCTCACACAGAACTCATTATGTTCTCTCCTGTGCATTTAATAAAGAATCTTAT
GTTTGTTTGAATTTCCGAATTTGGATAGTAACTTTTTGATGCAACCCTTGCAAAAAGAAAGTCTAGATGACCCAGTTATTGTTTCTTGATTAGTTTTTCTTTTCTCATCAATTGATTCTT
TTCTTTGCTTTTGCTTGTAGCTGGTATGTCAAGCATGATTGGACTTCCTTCAGATCGTGCACTTGTTGAGGATGATGAATGTTTGAGGTTTGTCATCTTCGAAGAGCCTCTTAAAACTTA
CCTGAATTCTATCAACTTCTTTTAAATGACTCTTAAGTGGTCATTAATTAGGAGATACTTTTAGAAATGAGATGTTGGGAACTGAAAACAATAAAAAATTTGTTAATAATCAACAATTAC
ATACAAAATTTTCTTATCTTTGATGCTTAAACTAATGCGCAGATGGATCAAGATGTATGCTGACAATCAGAATATGTTCTTTGAAGACTTCAAGAATGCTTACGTTAAACTAGTGAACTC
CGGAGCAAGGTGGAGAAGCTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTCATCAACTGCCTCCAGCCTCTGCGGCTGCTCCACCGCTTACTACTCTTCCCCTCTCCTCGCTCCCAAATTTAAATTCAAGTTTCCCGCCAAATCACAACGGTCCTCTCTCTCA
ACGGTCGAATTTCGCGCCAATCCCCTCACAATTTCTTCCTCCTTAGTCAACCACCGAG
GGAAAGATGGATCTTGCAATTCGAATAGGAGGAGGAGAGGACTGTTGCTTACGGCTACACTT
CCATTTCTTCTTCCTCTCCACGAATTTGTGCAAGACCTGGGCGCAAAAGCTGA
GTCAGGTATGAGTGACTATCTGCTTATGAAAGAAGAAGTGACTAAGGTAGTTTCAAAAGGCAAGGCT
GCTAGTGTACTTCGTCTTGCATTTCATGATGCAGGGACCTTTGAAATGGATGATAATTCGG
GTGGTATGAACGGTTCTATAGTTTATGAACTGGAAAGACCTGAAAATGCAGGCCTGAAC
AAGCCTTTGAAG
ATTCTAGAGAAAGCAAAGGGTGACGTGAATGCAATACGGCCAGTGTCATGGGCAGATATGATCGCTTTGGGTGGAGCTGTAGCAGTTTCAGTTTGCGGAGGTCCAAAC
ATCCCAGTTCCTATGGGCAGACTTGATTCAAT
GGAGCCTGATCCTGAAGGAAAACTTCCGCAAGAAACTTTGGATGCTTCTGGTTTGAAGCAATGCTTTCAAAGAAAAGGCTTCTCAGCA
CAAGAGCTAGTTGCTTTATCTGGAGCCCATACTCTTGGAACCAAAGGTTTTGGAAATCCAATAGTTTTCGACAATTCGTACTATAAAATTCTTTTAGAGAAGCCATGGCAGTCTTCAG
CT
GGTATGTCAAGCATGATTGGACTTCCTTCAGATCGTGCACTTGTTGAGGATGATGAATGTTTGAG
ATGGATCAAGATGTATGCTGACAATCAGAATATGTTCTTTGAAGACTTCAAGAAT
GCTTACGTTAAACTAGTGAACTCCGGAGCAAGGTGGAGAAGCTTGTGA

Retrieve as FASTA