Entry information : SbPrx72 (Sobic.004G105200.1[2.1] / SB04G008600[1.4])
Entry ID 838
Creation 2006-08-16 (Christophe Dunand)
Last sequence changes 2014-08-04 (Messaoudi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: SbPrx72 (Sobic.004G105200.1[2.1] / SB04G008600[1.4])
Name (synonym) SbPrx72 (Sobic.004G105200.1[2.1] / SB04G008600[1.4])
Class Class III peroxidase    [Orthogroup: Prx129]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Seedlings
Inducers Heat shock stress
Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx72
start..stop
S start..stop
ZmPrx67 534 0 24..321 25..320
ZmPrx36 528 0 24..321 25..323
SiPrx78 503 0 20..321 21..320
BdiPrx97 494 4e-178 5..321 7..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9998074..9998284 211 N° 2 9998382..9998577 196 N° 3 9998680..9998892 213 N° 4 9999007..9999077 71
join(9998074..9998284,9998382..9998577,9998680..9998892,9999007..9999077)


exon

Literature and cross-references SbPrx72 (Sobic.004G105200.1[2.1] / SB04G008600[1.4])
Literature Cordonnier-Pratt, M.-M. et al., unpublished.
DNA ref. Phytozome 12:   chromosome_4 (9998074..10057581) [Sequencing error]
EST ref. GenBank:   CD204432.1 [5' end]   CN135146.1 [5' end]   CD204323.1 [3' end]   CN135065 [Fragment]
Cluster/Prediction ref. UniGene:   Sbi.20406
Protein sequence: SbPrx72 (Sobic.004G105200.1[2.1] / SB04G008600[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (298)
PWM (Da):   %s   32749.15 (30578.8) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.43 (4.30) Peptide Signal:   %s   cut: 24 range:24-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARRLLLLPALLVAAALAGGAGAQLSAGFYSSTCPTVESVVRQAMSQAVTNNTRTGAAMLRLFFHDCFVNGCDASLLLDDTPTTPGEKGAGANAGASTSGFDLIDTIKTQVEAACPATVSCADILALAARDAVNLLGGPSWAVPLGRRDATFPNSTGAGTDLPGPDTDLDGLVAGFAAKGLTSRDLAALSGAHTVGMARCASFRTRVYCDDNVSPAFAAQQRGVCPVPAAGGDDALAPLDSLTPDEFDNGYYRSLMTGAGLLHSDQELFNNEALDSLVRLYGTNADAFSSDFAASMVRLGNIAPLTGAAGEIRLNCRTVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns) and 4 ESTs. Partial exon 4 due to the nnnn completed with ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGCGGTTGCTGCTCCTGCCGGCGCTGCTGGTCGCCGCCGCGCTCGCGGGCGGCGCGGGCGCGCAGCTCTCGGCGGGGTTCTACTCGTCGACCTGCCCCACCGTGGAAAGCGTC
GTGCGCCAGGCCATGTCGCAGGCCGTCACGAACAACACCCGCACCGGCGCCGCCATGCTCCGCCTCTTCTTCCACGACTGCTTCGTCAATG
TGAGTGTGAGCTTGAGCGACCGGCAATGC
TTGCTTATACGACATGCGTTCATTTAATACCGTGTAATTGGATCGTTCCTCTTCCTCCCCCCACCCAGGGCTGCGACGCCTCGCTGCTGCTGGACGACACGCCCACGACGCCCGGCGAGA
AGGGCGCCGGCGCCAACGCCGGCGCCTCCACCTCCGGCTTCGACCTCATCGACACCATCAAGACGCAGGTCGAGGCCGCCTGCCCCGCCACCGTCTCCTGCGCCGACATCCTCGCCCTCG
CCGCCCGCGACGCCGTCAACCTGG
TCTGTTGTTCCTCCCGCCCCGTGCTCTTCTTCTCTCCGCCCTTTTCCCGTTCCGTCTCTGCTCTGCAGCCCCCAGGCTAAACGTGCGTGTGGTGTG
CATCAGCTCGGCGGCCCGAGCTGGGCGGTGCCGCTGGGCCGGCGGGACGCGACGTTCCCGAACAGCACGGGCGCCGGGACGGACCTGCCCGGCCCTGACACCGACCTGGACGGCCTGGTG
GCCGGGTTCGCCGCCAAGGGCCTGACGTCGCGGGACCTGGCGGCGCTGTCGGGCGCGCACACGGTGGGGATGGCGCGGTGCGCGAGCTTCCGACCCGCN
NNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTGGCACATCGCCCCGCTCACGGGTG
CCGCCGGGGAGATCAGGCTCAACTGCAGGACAGTCAATTCGTGA

Retrieve as FASTA