Entry information : MpiCP01
Entry ID 8394
Creation 2011-05-17 (Christophe Dunand)
Last sequence changes 2011-05-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-06 (Christophe Dunand)
Peroxidase information: MpiCP01
Name MpiCP01
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Mycosphaerella
Organism Mycosphaerella pini (Dothistroma septosporum )    [TaxId: 64363 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MpiCP01
start..stop
S start..stop
CfulCP01 1486 0 1..760 1..760
ZcelCP01 1168 0 1..760 1..758
LpaluCP01 1167 0 5..760 3..753
MvarCP02 1157 0 5..760 3..752
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 462057..463403 1347 N° 2 459319..460254 936  
complement(join(459319..460254,462057..463403))


exon

Literature and cross-references MpiCP01
DNA ref. JGI genome:   scaffold_10 (463403..459319)
Cluster/Prediction ref. JGI gene:   47416
Protein sequence: MpiCP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   760
PWM (Da):   %s   83848.88  
PI (pH):   %s   6.29
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSQSECPVKNANIGGGGTRNRDWWPEALRLNILRQHTAQTNPFGEKQDYPSEFKKLNYDELKKDLHALMTDSQDYWPADFGHYGGLFIRMAWHSAGTYRVFDGRGGGGMGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGNKISWADLYLLTGNVALESMGFKPEGFAGGRPDTWEADESVYWGGESTWLGNEVRYSNGKEGLQGTQAPGAGVVDGDQSKKEHKDIHSRDLEEPIAAAHMGLIYVNPEGPDGVPDPIAAARDIRTTFGRMAMNDEETVALIAGGHSFGKTHGAAPSDNVSQEPEAAPIEAQGLGWTNKHGSGKGADTITSGLEVIWTKTPTKWSNNYLEYLYKYDWELTKSPAGANQWVAKTDEAIIPDAYDANKKHKPTMLTTDLSLRYDPSYDKISRRFLENPDQFADAFAKAWFKLLHRDMGPRSRWLGPEIPKEVHIWEDPVPEADHKLIDSNDASQLKQKILSSGIDTSALVRTAWASASTFRGSDKRGGANGARIRLEPQKNWKANNPQELAKVLSALEKIQQEFNGSGKKVSLADLIVLAGNAAVEKASGLKVPFSAGRTDATQEQTDAQTFEHLEPVVDGFRNYGTSPRPHRVRTEQFLIDRAQLLQLSAPEMTALVGGLRALNANYDGSNIGVFTTRPGQLTNDFFANLLDARLDWKATGSGKEQYEAVDRKTGEKKWVGSRSDLIFGSHAELRAIAEVYGSTDGEQKFKNDFVAAWAKIMDLDRFDLTSSGNSSASARL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCAAAGCGAGTGTCCAGTTAAGAACGCCAACATCGGCGGTGGCGGCACCAGGAACCGCGACTGGTGGCCAGAGGCGTTGAGGCTAAACATCCTCCGCCAGCACACCGCACAAACC
AACCCATTTGGCGAGAAGCAGGACTACCCGTCAGAGTTCAAGAAGCTCAACTATGACGAGCTTAAGAAGGACCTTCACGCATTAATGACGGACTCGCAAGATTACTGGCCAGCCGACTTT
GGCCACTATGGTGGCCTCTTCATTCGAATGGCATGGCACAGTGCAGGCACATACCGTGTATTCGACGGACGAGGCGGAGGTGGTATGGGACAACAGCGATTCGCCCCACTCAACAGCTGG
CCAGACAACGTCTCCCTCGACAAGGCCCGACGTTTGCTGTGGCCAATCAAGCAGAAGTACGGCAACAAGATTTCTTGGGCAGATCTCTACCTGCTCACTGGCAACGTCGCTCTCGAGTCC
ATGGGCTTCAAACCTGAGGGTTTCGCAGGCGGTCGTCCAGACACCTGGGAGGCGGACGAGTCCGTCTACTGGGGTGGCGAGAGCACTTGGCTCGGCAACGAGGTTCGATACTCCAATGGT
AAGGAGGGTCTGCAAGGCACACAAGCACCAGGCGCTGGTGTCGTCGACGGCGACCAGTCTAAGAAGGAGCACAAGGATATCCATTCCCGCGACCTTGAGGAGCCAATTGCTGCCGCCCAC
ATGGGTCTCATCTACGTGAATCCCGAGGGTCCAGATGGTGTGCCAGATCCGATCGCCGCCGCGCGCGACATCCGCACCACCTTCGGCCGCATGGCCATGAACGACGAGGAGACCGTTGCA
CTTATCGCAGGTGGTCACTCGTTCGGAAAGACTCACGGTGCTGCTCCATCTGACAACGTCTCGCAAGAGCCAGAGGCCGCACCAATCGAGGCCCAGGGTCTTGGCTGGACCAACAAGCAC
GGCTCCGGCAAGGGAGCAGATACCATCACATCTGGTCTCGAAGTCATCTGGACCAAGACACCAACCAAATGGAGCAACAACTACCTCGAGTACTTGTACAAGTACGATTGGGAGCTGACC
AAGTCTCCAGCTGGTGCCAACCAGTGGGTTGCTAAGACCGACGAGGCCATCATCCCAGATGCCTACGACGCCAACAAGAAGCACAAGCCAACTATGTTGACCACCGATCTGTCCCTCCGA
TATGACCCGTCCTACGACAAGATCTCCCGTCGCTTCCTCGAGAACCCAGACCAGTTTGCCGACGCTTTTGCCAAGGCATGGTTCAAGCTCCTTCACCGCGACATGGGTCCACGATCCCGC
TGGCTCGGTCCAGAGATTCCAAAGGAG
GTGCACATCTGGGAGGACCCAGTGCCAGAGGCCGACCACAAGCTCATCGACTCGAATGATGCTAGTCAGCTGAAGCAGAAGATTCTGTCTTCT
GGCATTGACACATCTGCCCTCGTTCGCACTGCATGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNACACAAGCACCAGGCGCTGGTGTCGTCGACGGCGACCAGTCTAAGAAGGAGCACAAGGATATCCATTCCCGCGACCTTGAGGAGCCAATTGCTGCCGCCC
ACATGGGTCTCATCTACGTGAATCCCGAGGGTCCAGATGGTGTGCCAGATCCGATCGCCGCCGCGCGCGACATCCGCACCACCTTCGGCCGCATGGCCATGAACGACGAGGAGACCGTTG
CACTTATCGCAGGTGGTCACTCGTTCGGAAAGACTCACGGTGCTGCTCCATCTGACAACGTCTCGCAAGAGCCAGAGGCCGCACCAATCGAGGCCCAGGGTCTTGGCTGGACCAACAAGC
ACGGCTCCGGCAAGGGAGCAGATACCATCACATCTGGTCTCGAAGTCATCTGGACCAAGACACCAACCAAATGGAGCAACAACTACCTCGAGTACTTGTACAAGTACGATTGGGAGCTGA
CCAAGTCTCCAGCTGGTGCCAACCAGTGGGTTGCTAAGACCGACGAGGCCATCATCCCAGATGCCTACGACGCCAACAAGAAGCACAAGCCAACTATGTTGACCACCGATCTGTCCCTCC
GATATGACCCGTCCTACGACAAGATCTCCCGTCGCTTCCTCGAGAACCCAGACCAGTTTGCCGACGCTTTTGCCAAGGCATGGTTCAAGCTCCTTCACCGCGACATGGGTCCACGATCCC
GCTGGCTCGGTCCAGAGATTCCAAAGGAGGTGCACATCTGGGAGGACCCAGTGCCAGAGGCCGACCACAAGCTCATCGACTCGAATGATGCTAGTCAGCTGAAGCAGAAGATTCTGTCTT
CTGGCATTGACACATCTGCCCTCGTTCGCACTGCATGGGCATCTGCATCCACATTCCGTGGCAGCGACAAGCGTGGTGGTGCCAACGGTGCACGCATCCGCCTCGAGCCACAGAAGAACT
GGAAGGCAAACAACCCACAGGAGCTTGCCAAAGTTCTAAGCGCGCTCGAGAAGATTCAGCAGGAGTTCAACGGCAGCGGCAAAAAGGTGTCTCTCGCTGACTTGATCGTCCTCGCTGGTA
ACGCCGCCGTCGAGAAGGCATCTGGTCTCAAGGTTCCGTTCAGCGCTGGTCGCACTGATGCCACCCAGGAGCAGACCGATGCTCAGACTTTCGAGCACCTCGAGCCAGTCGTGGACGGTT
TCCGTAACTACGGCACTTCGCCACGCCCACACCGTGTCCGCACGGAGCAGTTCCTTATTGACCGCGCACAGCTTCTCCAGCTTTCTGCACCAGAGATGACCGCGCTTGTTGGTGGTCTTC
GTGCGCTCAACGCCAATTACGATGGCTCGAACATCGGCGTCTTCACTACTCGTCCCGGTCAGCTCACCAACGACTTCTTTGCCAACCTCCTCGATGCCCGCCTTGACTGGAAGGCTACTG
GCTCCGGCAAGGAGCAGTATGAGGCTGTTGACCGCAAGACTGGCGAGAAGAAGTGGGTTGGAAGCCGCTCTGACCTGATTTTCGGTTCGCACGCCGAGCTTCGTGCCATTGCTGAGGTTT
ACGGCAGCACCGACGGCGAGCAGAAGTTCAAGAACGACTTCGTCGCTGCTTGGGCCAAGATCATGGACCTTGACCGCTTTGACCTTACCAGCAGTGGTAACTCTTCGGCTTCCGCCCGTT
TGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCAAAGCGAGTGTCCAGTTAAGAACGCCAACATCGGCGGTGGCGGCACCAGGAACCGCGACTGGTGGCCAGAGGCGTTGAGGCTAAACATCCTCCGCCAGCACACCGCACAAACC
AACCCATTTGGCGAGAAGCAGGACTACCCGTCAGAGTTCAAGAAGCTCAACTATGACGAGCTTAAGAAGGACCTTCACGCATTAATGACGGACTCGCAAGATTACTGGCCAGCCGACTTT
GGCCACTATGGTGGCCTCTTCATTCGAATGGCATGGCACAGTGCAGGCACATACCGTGTATTCGACGGACGAGGCGGAGGTGGTATGGGACAACAGCGATTCGCCCCACTCAACAGCTGG
CCAGACAACGTCTCCCTCGACAAGGCCCGACGTTTGCTGTGGCCAATCAAGCAGAAGTACGGCAACAAGATTTCTTGGGCAGATCTCTACCTGCTCACTGGCAACGTCGCTCTCGAGTCC
ATGGGCTTCAAACCTGAGGGTTTCGCAGGCGGTCGTCCAGACACCTGGGAGGCGGACGAGTCCGTCTACTGGGGTGGCGAGAGCACTTGGCTCGGCAACGAGGTTCGATACTCCAATGGT
AAGGAGGGTCTGCAAGGCACACAAGCACCAGGCGCTGGTGTCGTCGACGGCGACCAGTCTAAGAAGGAGCACAAGGATATCCATTCCCGCGACCTTGAGGAGCCAATTGCTGCCGCCCAC
ATGGGTCTCATCTACGTGAATCCCGAGGGTCCAGATGGTGTGCCAGATCCGATCGCCGCCGCGCGCGACATCCGCACCACCTTCGGCCGCATGGCCATGAACGACGAGGAGACCGTTGCA
CTTATCGCAGGTGGTCACTCGTTCGGAAAGACTCACGGTGCTGCTCCATCTGACAACGTCTCGCAAGAGCCAGAGGCCGCACCAATCGAGGCCCAGGGTCTTGGCTGGACCAACAAGCAC
GGCTCCGGCAAGGGAGCAGATACCATCACATCTGGTCTCGAAGTCATCTGGACCAAGACACCAACCAAATGGAGCAACAACTACCTCGAGTACTTGTACAAGTACGATTGGGAGCTGACC
AAGTCTCCAGCTGGTGCCAACCAGTGGGTTGCTAAGACCGACGAGGCCATCATCCCAGATGCCTACGACGCCAACAAGAAGCACAAGCCAACTATGTTGACCACCGATCTGTCCCTCCGA
TATGACCCGTCCTACGACAAGATCTCCCGTCGCTTCCTCGAGAACCCAGACCAGTTTGCCGACGCTTTTGCCAAGGCATGGTTCAAGCTCCTTCACCGCGACATGGGTCCACGATCCCGC
TGGCTCGGTCCAGAGATTCCAAAGGAG
GTGCACATCTGGGAGGACCCAGTGCCAGAGGCCGACCACAAGCTCATCGACTCGAATGATGCTAGTCAGCTGAAGCAGAAGATTCTGTCTTCT
GGCATTGACACATCTGCCCTCGTTCGCACTGCATGGGCATCTGCATCCACATTCCGTGGCAGCGACAAGCGTGGTGGTGCCAACGGTGCACGCATCCGCCTCGAGCCACAGAAGAACTGG
AAGGCAAACAACCCACAGGAGCTTGCCAAAGTTCTAAGCGCGCTCGAGAAGATTCAGCAGGAGTTCAACGGCAGCGGCAAAAAGGTGTCTCTCGCTGACTTGATCGTCCTCGCTGGTAAC
GCCGCCGTCGAGAAGGCATCTGGTCTCAAGGTTCCGTTCAGCGCTGGTCGCACTGATGCCACCCAGGAGCAGACCGATGCTCAGACTTTCGAGCACCTCGAGCCAGTCGTGGACGGTTTC
CGTAACTACGGCACTTCGCCACGCCCACACCGTGTCCGCACGGAGCAGTTCCTTATTGACCGCGCACAGCTTCTCCAGCTTTCTGCACCAGAGATGACCGCGCTTGTTGGTGGTCTTCGT
GCGCTCAACGCCAATTACGATGGCTCGAACATCGGCGTCTTCACTACTCGTCCCGGTCAGCTCACCAACGACTTCTTTGCCAACCTCCTCGATGCCCGCCTTGACTGGAAGGCTACTGGC
TCCGGCAAGGAGCAGTATGAGGCTGTTGACCGCAAGACTGGCGAGAAGAAGTGGGTTGGAAGCCGCTCTGACCTGATTTTCGGTTCGCACGCCGAGCTTCGTGCCATTGCTGAGGTTTAC
GGCAGCACCGACGGCGAGCAGAAGTTCAAGAACGACTTCGTCGCTGCTTGGGCCAAGATCATGGACCTTGACCGCTTTGACCTTACCAGCAGTGGTAACTCTTCGGCTTCCGCCCGTTTG
TAG

Retrieve as FASTA