Entry information : CowKat01 (CowKatE)
Entry ID 8409
Creation 2011-05-30 (Marcel Zamocky)
Last sequence changes 2011-05-30 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-05-31 (Christophe Dunand)
Peroxidase information: CowKat01 (CowKatE)
Name (synonym) CowKat01 (CowKatE)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Ichthyosporea Capsaspora
Organism Capsaspora owczarzaki    [TaxId: 192875 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CowKat01
start..stop
S start..stop
RoKat01 706 0 4..481 6..482
PblKat01 691 0 4..477 6..478
DdKat01 683 0 4..476 6..480
DpuKat01 674 0 4..476 6..480
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 930658..930737 80 N° 2 928700..930071 1372  
complement(join(928700..930071,930658..930737))


exon

Literature and cross-references CowKat01 (CowKatE)
Literature Russ, C., Cuomo, C. et al. The genome sequence of Capsaspora owczarzaki ATCC 30864. (Unpublished since 2009).
Protein ref. UniProtKB:   E9C033
DNA ref. GenBank:   GG697243.1 (930737..928700)
EST ref. GenBank:   EC739668.1 [5' end]
Protein sequence: CowKat01 (CowKatE)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   483
PWM (Da):   %s   54073.95  
PI (pH):   %s   8.64
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LKRRRALQQTLLDASAIVRVALAENLNGMTWMQTFQLG*LPFSIESKRSWVA*SGFSALSLLACSGVRFLTPCSVLKWNLTKFCAPLAFTILSVCEEKPCMWRYPSGVPRLEKRMLTWWHDSGVCDKKSQNMSASGRLVCGLRFWVWIKSGNLIGSRMKKMGVLLPTMSQLPSSV*NLTANPRGSRAVSAEPFSPPTVEKRVKSGVRLPTRSRNLALHRWDTSLVTSK*PCAPAPFACTTRSGMRSRSK*ASLSIKWKSWSSLHSFR*RRGRNPTKMVRKSRNGANKTIITIKSEKGAKVRENNDSSYAGGKK*RSRQQ*KQSQKSRKRSILKKKEKKKKKQRQKDGRAILCAGCVLPSPFELRLRNDDDRPHEHPSVDGAVGRSNVPPSPPSPPRFVLDKTKESSGAANCRRMIFSSASSRFRFGLPLASSTRASKEGMCSYQDCGAATNGRE*SVQGPSLACTEAVLVVDNRSSVAGCKAR

Retrieve as FASTA  
Remarks complete sequence from genomic (1 intron) and 2 ESTs. Strain="ATCC 30864". Clade 3 catalase, NADPH binding site present.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTAAAGCGCAGAAGAGCTCTTCAGCAGACCCTGCTCGATGCGAGCGCCATAGTCAGAGTCGCACTTGCGGAAAATCTCAACCTGGCGCTTTTGGAGGTGCTTCTTGGCGCCGCTGAGATG
TCCAACAATGTTGTTCACGAGGGCGGTCTTCTCTTCGGCGGAGAGGAGGCGGTAGAGGTCGCCGGCCTGCTTGAAGTCGTCCTGGTTCTTCCAGGCGGGAGGGTGGTGGCCGACGGTGCC
AGAAACCTCGTAAGGGGAGGCGTCGGTCGTCGTCTTGTCCTCCTTGGGTCCGCCGAACGAGCTGGGCTCGTAGTTGGGGAGCTTGCCGCCGTTGCCGTTGATGGCCATGAAGCCGTCGCG
CTGGTGGTTGCTGACGCGGGCAGCGTAAGGGCAGTTGACGGGGATTTGCAGGTAGTTGGCACCCAGGCGGTGACGGTGGGTGTCCGGGTACGAGAACAAGCGGCCCTGGAGCATCTTGTC
GGGCGAGGGCTCGATGCCGGGCACCATGTGCGAGGGGGAGAAGGCAGCCTGCTCGACCTCGGCAAAGTAGTTCTCGGGGTTGCGGTTGAGAACCATGCGGCCAATCTCCTGGAGCGGGTA
GGCCTTTTGCGACCACACCTTGGTCACGTCGAAGGGGTTGAAGGCCTGCTTGGGCACGTCCGCGAGCGGCATGACCTGGATGCAGACCTTCCAGCTCGGGTAGTTGCCCTTTTCGATCGA
GTCAAAGAGGTCCTGGGTGGCATAGTCGGGGTTTTCCGCCTTGAGCTTGTTGGCCTGCTCGGGGGTGAGGTTCTTGACGCCCTGCTCGGTCTTGAAGTGGAACTTGACAAAGTTCTGCGC
GCCCTTGGCGTTCACCATCTTGAGCGTGTGCGAGGAGAAGCCGTGCATGTGGCGGTACCCGTCGGGGGTGCCGCGGCTCGAGAAGAGAATGCTGACCTGGTGGCACGACTCTGGGGTCTG
CGACAAAAAGTCCCAGAACATGTCCGCATCGGGCAGGTTGGTCTGCGGGTTGCGCTTCTGGGTGTGGATAAAGTCCGGGAACTTGATCGGGTCGCGGATGAAGAAGATGGGCGTGTTGTT
GCCAACCATGTCCCAGTTGCCCTCCTCAGTGTAGAACTTGACGGCAAACCCGCGGGGATCGCGCGCCGTGTCTGCCGAGCCCTTCTCGCCACCCACCGTCGAGAAGCGCGTGAAGAGCGG
CGTGCGCTTGCCAACGCGCTCGAGGAACTTGGCCTTGCACAGGTGGGACACGTCCTTGGTCACCTCAAAGTAGCCGTGCGCGCCAGCACCCTTCGCATGCACGACGCGTTCCGGGATGCG
CTCGCGGTCAAAGTGAGCAAGCTTGTCGATAAAGTGGAAGTCCTGGAGCAGCCTGCATTCATTCAGGTGACGAAGGGGAAGAAATCCAACAAAAATGGTGAGAAAAAGCCGAAACGGTGC
GAACAAAACAATCATTACAATCAAGAGCGAGAAGGGGGCAAAAGTGAGAGAGAATAACGATTCAAGCTATGCTGGGGGCAAGAAATAGAGAAGCCGCCAGCAGTGAAAACAAAGCCAGAA
GAGCAGGAAGCGATCAATTTTAAAAAAAAAAGAAAAAAAAAAAAAGAAGCAAAGACAAAAAGACGGACGCGCCATTCTGTGCGCAGGTTGTGTGCTGCCATCGCCGTTTGAATTGCGTCT
CAGAAACGACGACGACAGGCCACACGAGCACCCCTCAGTTGATGGAGCAGTGGGACGGTCCAACGTGCCCCCTTCCCCCCCATCTCCGCCCCGCTTCGTTCTAGACAAGACAAAAGAGTC
AAGCGGGGCGGCAAACTGCCGTCGGATGATCTTTTCGTCCGCCTCGAGCCGCTTTCGCTTTGGGCTGCCTCTGGCTTCATCAACCCGGGCGAGCAAGGAGGGAATGTGCAGTTATCAAGA
CTGTGGCGCTGCAACAAACGGAAGGGAGTGAAGCGTACAGGGGCCCAGTCTCGCCTGCACTGAGGCTGTTCTGGTTGTCGACAACAGGAGTTCCGTTGCTGGTTGTAAGGCGCGACAT

Retrieve as FASTA