Entry information : NgrKat01
Entry ID 8410
Creation 2011-05-30 (Marcel Zamocky)
Last sequence changes 2011-05-30 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-05-31 (Christophe Dunand)
Peroxidase information: NgrKat01
Name NgrKat01
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Heterolobosea Vahlkampfiidae Naegleria
Organism Naegleria gruberi    [TaxId: 5762 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NgrKat01
start..stop
S start..stop
PpalKat01 690 0 13..486 6..482
MbaKat01 672 0 10..486 7..483
TthKat01 669 0 10..486 7..481
DdKat01 662 0 12..486 5..482
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 76671..76702 32 N° 2 76397..76525 129 N° 3 75027..76335 1309  
complement(join(75027..76335,76397..76525,76671..76702))


exon

Literature and cross-references NgrKat01
Literature Fritz-Laylin L.K., Prochnik S.E., Ginger M.L., Dacks J.B., Carpenter M.L., Field M.C., Kuo A., Paredez A., Chapman J., Pham J., Shu S., Neupane R., Cipriano M., Mancuso J., Tu H., Salamov A., Lindquist E., Shapiro H. , Lucas S., Grigoriev I.V., Cande W.Z., Fulton C., Rokhsar D.S., Dawson S.C. (2010) The genome of Naegleria gruberi illuminates early eukaryotic versatility. Cell 140:631-642.
Protein ref. UniProtKB:   D2VWQ6
DNA ref. GenBank:   GG738905.1 (76702..75027)
EST ref. GenBank:   FE268988.1 [5' end]   FE247030.1 [3' end]
Protein sequence: NgrKat01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   489
PWM (Da):   %s   55234.78  
PI (pH):   %s   8.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTNFNYDYTSTLTDEFGHPVADNNNSLTAGNNGPILLQDTYLISKLAHFDRERIPERVVHAKGAGAHGYFEVTHDITKFTKAAFLNRVGKRTPVFARFSTVGGEKGSADSDRDPRGFAVKFYTEEGNYDFVGNNTPVFFIRDTIKFPDFIHTQKRNPQSNLKDPDAFWDFLSLTPESVHQLTVLFSDRGTPFSYRHMNGYSGHTFKLVNSQGEAFWAKIHFKTEQGIKNLTVEEATRLAGEDPDHATRDLFNSIKQGSSPAWKVYFQIMPVDDAAKYKVDVFDITKVWAHKDYPLIPVGRMVLNRNPNNYFAETEQSAFSPSNLVPGIEPSLDKMLQGRLFSYPDTHRHRLGANYAQIPINAPLKAKLNCQFRDGSMTVNGNGGSAPNYEPNTFGGPYEAKQLIEHPTKVQGAITRSKPNHPNDDYVQAGTLYREVMTEYDRSRLVHNIALHLKNAKKEIQLRQLQIFYKADKDYGRRIAELLGLQNL

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 19 ESTs. Strain="NEG-M". Clade 3 catalase with NADPH binding site.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTACAAGTTTTGCAAGCCCAACAATTCAGCAATTCTACGACCATAATCCTTATCAGCCTTATAGAAGATTTGTAATTGTCTCAATTGAATTTCCTTCTTGGCATTCTTCAAGTGCAAAGC
AATATTGTGAACAAGTCTAGAACGATCATATTCAGTCATAACTTCACGATACAAAGTACCAGCTTGGACGTAGTCATCATTTGGATGATTTGGCTTGGAACGAGTAATGGCACCTTGAAC
CTTAGTTGGGTGTTCAATCAATTGCTTAGCTTCATATGGACCACCGAATGTGTTTGGTTCATAGTT
TGGAGCAGAACCACCGTTACCATTGACAGTCATGGAACCATCTCTGAATTGACA
GTTCAATTTAGCCTTAAGTGGAGCATTAATTGGAATTTGAGCATAGTTAGCGCCCAATCTATGTCTGTGAGTATCTGGATAAGAGAAAAGTCTACCTTGGAGCATCTTGTCAAGGGATGG
TTCAATACCAGGAACCAAGTTAGATGGAGAGAATGCAGATTGTTCAGTTTCGGCAAAGTAATTGTTTGGATTACGATTCAAAACCATTCTACCAACTGGAATGAGTGGATAATCCTTGTG
TGCCCAAACCTTAGTAATATCAAAAACATCAACTTTGTACTTGGCAGCATCATCAACTGGCATAATTTGGAAATAAACCTTCCAAGCTGGGCTGCTTCCTTGCTTAATTGAGTTGAACAA
ATCACGAGTAGCATGATCTGGATCTTCACCAGCCAAACGAGTGGCTTCTTCAACAGTCAAATTCTTAATACCTTGTTCAGTCTTGAAGTGAATCTTAGCCCAGAAAGCTTCACCTTGTGA
GTTAACCAATTTGAAAGTGTGACCAGAATAACCGTTCATGTGACGATAAGAAAATGGTGTACCTCTATCACTGAACAAAACAGTAAGTTGGTGAACTGATTCTGGAGTCAAACTCAAAAA
GTCCCAGAATGCATCAGGATCCTTCAAGTTTGATTGTGGATTTCTCTTTTGGGTATGGATAAAATCTGGGAATTTAATAGTGTCACGAATGAAGAAAACTGGAGTATTATTACCAACAAA
ATCATAATTTCCTTCTTCAGTATAGAATTTAACAGCAAAACCTCTTGGATCTCTATCAGAATCGGCACTACCCTTTTCACCACCAACAGTGGAAAAACGAGCAAAAACTGGAGTTCTCTT
ACCAACACGATTCAAGAATGCAGCCTTGGTGAATTTAGTGATATCATGAGTGACTTCAAAATAACCATGAGCACCAGCACCCTTTGCGTGAACAACTCTTTCTGGGATTCTATTATAATG
CAACAATTAAAATGTATAAAATTAATAAAACAATGTCTTATAATACTAACCTTTCACGATCAAAGTGGGCCAATTTGCTGATCAAATAAGTATCTTGCAAAAGGATTGGTCCATTATTGC
CAGCTGTGAGGGAATTGTTGTTATCAGCAACTGGATGGCCAAATTCATCAGTCAAAGTACTGTTGTTGTATAATAATATTATGAATGATGAAAAGCATTTTAATATTAATCAATCGACAT
ATAATTTTAATGTGTCGTAAATTAAAGAAGATAGGAAAATTCGCACAAAATTGATGAGCACTAGGTTATTGCTCTGAAACCTACCTGGTGTAATCGTAGTTAAAGTTGGTAGACAT

Retrieve as FASTA