Entry information : AnGPx
Entry ID 8414
Creation 2011-05-30 (Christophe Dunand)
Last sequence changes 2012-04-23 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-22 (Achraf Jemmat)
Peroxidase information: AnGPx
Name AnGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus niger    [TaxId: 5061 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AnGPx
start..stop
S start..stop
AcarGPx01 397 1e-141 1..269 1..261
NfGPx 342 3e-120 65..270 24..231
AfumGPx 340 2e-119 71..268 32..228
PEchGPx01 338 3e-119 85..271 1..187
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2072840..2073134 295 N° 2 2073220..2073743 524  
join(2072840..2073134,2073220..2073743)


exon

Literature and cross-references AnGPx
DNA ref. JGI genome:   chr_4_2 (2072840..2073743)
EST ref. GenBank:   EY241754.1 [5' end]   EY232108.1 [3' end]
Protein sequence: AnGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   273
PWM (Da):   %s   30198.77  
PI (pH):   %s   9.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLSSIIPFTDLSSPRSRLASSTTYLVAHSLVPVRFIRTTAPTGPYHLATSLRSSHRNIFPLQRIYSPPSLPSSHSPRLRLLSTMSSATSFYDFEPVDKKGSPFPLIDLKGKVVLVVNTASKCGFTPQFQGLEKLYQDIKAKHPEDFTIIGFPCNQFGSQDPGSDDEIQSFCQINYGVTFPVLGKSDVNGDKAAPVWTWMKEQQPGLLGLKRIKWNFEKFLISADGKVVGRWASLTKPESLEEPILKEIEKAKKEGSLASLKKEEAKAEEAT

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron) and 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTTGTCATCGATCATCCCATTCACTGATTTATCATCCCCAAGGTCGAGACTCGCCTCGTCAACTACATATCTAGTGGCGCATTCCCTGGTACCAGTACGATTCATCAGAACTACT
GCTCCTACTGGTCCATATCACCTTGCGACATCACTGCGATCAAGCCATCGGAACATTTTTCCTCTCCAGCGCATTTACTCACCACCATCACTTCCATCGTCGCATTCCCCAAGACTAAGA
CTACTATCAACCATGTCTTCCGCAACGTCCTTCTACGACTTTGAGCCTGTCGATA
GTACGTTATTCGCCCTTCTTCACTTGCTTTTTAAATGCCATACCCCCACTTCATTTCCAACTAAC
CACCCCTCTCACCCGCACAGAAAAGGGCTCCCCCTTCCCCCTCATCGACCTCAAGGGCAAAGTCGTCCTCGTCGTCAACACCGCCTCTAAGTGCGGCTTCACGCCTCAGTTCCAAGGCCT
GGAGAAACTCTACCAAGACATCAAAGCCAAGCACCCGGAAGACTTCACCATCATCGGATTCCCCTGCAACCAGTTCGGAAGCCAGGACCCCGGTTCCGACGACGAGATCCAGTCGTTCTG
CCAGATCAACTACGGAGTGACGTTCCCTGTGCTGGGCAAGTCGGACGTTAATGGCGATAAGGCCGCGCCGGTGTGGACATGGATGAAGGAGCAGCAGCCCGGTCTGTTGGGGCTGAAGCG
CATCAAGTGGAACTTTGAGAAGTTCTTGATTTCGGCGGATGGAAAGGTTGTGGGTCGCTGGGCTAGTTTGACCAAGCCCGAGTCCTTGGAGGAGCCCATTCTGAAGGAGATTGAGAAGGC
GAAGAAGGAGGGCTCGTTGGCTTCGTTGAAGAAGGAGGAGGCCAAGGCTGAGGAGGCGACGGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTTGTCATCGATCATCCCATTCACTGATTTATCATCCCCAAGGTCGAGACTCGCCTCGTCAACTACATATCTAGTGGCGCATTCCCTGGTACCAGTACGATTCATCAGAACTACT
GCTCCTACTGGTCCATATCACCTTGCGACATCACTGCGATCAAGCCATCGGAACATTTTTCCTCTCCAGCGCATTTACTCACCACCATCACTTCCATCGTCGCATTCCCCAAGACTAAGA
CTACTATCAACCATGTCTTCCGCAACGTCCTTCTACGACTTTGAGCCTGTCGATA
AAAAGGGCTCCCCCTTCCCCCTCATCGACCTCAAGGGCAAAGTCGTCCTCGTCGTCAACACCGCC
TCTAAGTGCGGCTTCACGCCTCAGTTCCAAGGCCTGGAGAAACTCTACCAAGACATCAAAGCCAAGCACCCGGAAGACTTCACCATCATCGGATTCCCCTGCAACCAGTTCGGAAGCCAG
GACCCCGGTTCCGACGACGAGATCCAGTCGTTCTGCCAGATCAACTACGGAGTGACGTTCCCTGTGCTGGGCAAGTCGGACGTTAATGGCGATAAGGCCGCGCCGGTGTGGACATGGATG
AAGGAGCAGCAGCCCGGTCTGTTGGGGCTGAAGCGCATCAAGTGGAACTTTGAGAAGTTCTTGATTTCGGCGGATGGAAAGGTTGTGGGTCGCTGGGCTAGTTTGACCAAGCCCGAGTCC
TTGGAGGAGCCCATTCTGAAGGAGATTGAGAAGGCGAAGAAGGAGGGCTCGTTGGCTTCGTTGAAGAAGGAGGAGGCCAAGGCTGAGGAGGCGACGGCT

Retrieve as FASTA