Entry information : SbPrx136 (Sobic.010G161800.1 [2.1] / SB10G021630 [1.4])
Entry ID 842
Creation 2006-01-02 (Christophe Dunand)
Last sequence changes 2011-01-18 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx136 (Sobic.010G161800.1 [2.1] / SB10G021630 [1.4])
Name (synonym) SbPrx136 (Sobic.010G161800.1 [2.1] / SB10G021630 [1.4])
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Roots
Inducers Acid treatment
Alkaline treatment
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx136
start..stop
S start..stop
ZmPrx106 571 0 5..329 6..323
SiPrx34 555 0 5..329 2..325
BdiPrx25 526 0 6..329 2..322
OsPrx88 525 0 28..329 21..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47763373..47763606 234 N° 2 47763072..47763263 192 N° 3 47762354..47762917 564  
complement(join(47762354..47762917,47763072..47763263,47763373..47763606))


exon

Literature and cross-references SbPrx136 (Sobic.010G161800.1 [2.1] / SB10G021630 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_10 (47763606..47762354)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.16835.1
Protein sequence: SbPrx136 (Sobic.010G161800.1 [2.1] / SB10G021630 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (301)
PWM (Da):   %s   34187.96 (31420.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.32 (7.98) Peptide Signal:   %s   cut: 29 range:29-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVVRASSVIRCLLTVAAVLSLLMAGAAAAGGGLSTSFYSKKCPNVQSIVRAGMASAVAAEKRMGASILRMFFHDCFVNGCDASILLDDTATFTGEKNAGPNANSVRGYEVIDAIKTQVEASCNATVSCADILALAARDAVNLLGGPTWTVYLGRRDARTASQSDANGNLPGPGSSLATLVTMFGNKGLSARDMTALSGAHTVGQARCTTFRSRIYGDTNINATFASLRQQTCPQASDGGAGDAALAPIDVRTPEAFDNAYYQNLMARQGLFHSDQELFNGGSQDALVKKYSGNAAMFAADFAKAMVRMGAISPLTGTQGEVRLDCRKVN*

Retrieve as FASTA  
Remarks Complete sequence from 4 ESTs (Missing sequence between CP and GEIR), from 4 EST (TC102069, SCADIL sequence is missing) and genomic (chromo 10, introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGTGAGAGCATCATCAGTGATAAGGTGCTTGCTGACGGTGGCCGCGGTGCTGTCTCTCCTGATGGCCGGTGCCGCTGCTGCCGGCGGCGGTCTGTCGACGAGCTTCTACAGCAAG
AAGTGCCCGAACGTGCAGAGCATCGTGCGGGCCGGGATGGCGTCGGCCGTGGCGGCGGAGAAGCGCATGGGCGCCTCCATCCTCCGCATGTTCTTCCACGACTGCTTCGTCAAT
GTACAT
TGATTGCATTTTAATCTGTCACCTGTTTCCGATAGATGCATGCACTGTACAGCGTCATTACTGATGGCTGGGAGCGTTGTGGTGGTGGCCGGCCGGGTTGCAGGGCTGTGACGCGTCCAT
CTTGCTGGACGACACGGCGACCTTCACCGGCGAGAAGAACGCCGGGCCCAACGCCAACTCCGTGCGCGGGTACGAGGTCATCGACGCCATCAAGACCCAGGTCGAGGCGTCCTGCAACGC
CACCGTCTCCTGCGCCGACATCCTCGCCCTCGCTGCCCGGGACGCTGTCAACCTC
GTACGTACGGCGCGGCGCCGGCGCGTTTCATTTCATCCGAGCATCAGCGCCGCCGCCAGGCGGCC
AGAGCATCCATGACACGATGCAATGCTTTGTTACAAGCTGCCACTGACGCGAGACCTGACACATCCACCTTCCTGAATAATGCATGCAGCTCGGCGGGCCGACGTGGACGGTGTACCTCG
GCCGGCGGGACGCGCGGACGGCGAGCCAGAGCGACGCGAACGGCAACCTCCCGGGGCCAGGGTCGAGCCTCGCCACCCTCGTCACCATGTTCGGCAACAAGGGCCTGTCGGCGCGCGACA
TGACGGCGCTGTCGGGCGCGCACACCGTCGGGCAGGCCCGGTGCACCACCTTCCGCAGCCGCATCTACGGCGACACCAACATCAACGCCACCTTCGCGTCGCTCCGGCAGCAGACGTGCC
CGCAGGCCAGCGACGGCGGCGCCGGCGACGCCGCGCTGGCGCCCATCGACGTCCGGACCCCCGAGGCGTTCGACAACGCCTACTACCAGAACCTGATGGCCAGGCAAGGGCTGTTCCACT
CGGACCAGGAGCTCTTCAACGGCGGCTCGCAGGACGCGCTGGTGAAGAAGTACAGCGGCAACGCCGCCATGTTCGCCGCCGACTTCGCCAAGGCGATGGTGAGGATGGGCGCCATCAGCC
CGCTCACGGGGACGCAGGGCGAGGTCAGGCTCGACTGCAGGAAGGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGTGAGAGCATCATCAGTGATAAGGTGCTTGCTGACGGTGGCCGCGGTGCTGTCTCTCCTGATGGCCGGTGCCGCTGCTGCCGGCGGCGGTCTGTCGACGAGCTTCTACAGCAAG
AAGTGCCCGAACGTGCAGAGCATCGTGCGGGCCGGGATGGCGTCGGCCGTGGCGGCGGAGAAGCGCATGGGCGCCTCCATCCTCCGCATGTTCTTCCACGACTGCTTCGTCAAT
GGCTGT
GACGCGTCCATCTTGCTGGACGACACGGCGACCTTCACCGGCGAGAAGAACGCCGGGCCCAACGCCAACTCCGTGCGCGGGTACGAGGTCATCGACGCCATCAAGACCCAGGTCGAGGCG
TCCTGCAACGCCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCTGCCCGGGACGCTGTCAACCTC
CTCGGCGGGCCGACGTGGACGGTGTACCTCGGCCGGCGGGACGCGCGGACGGCG
AGCCAGAGCGACGCGAACGGCAACCTCCCGGGGCCAGGGTCGAGCCTCGCCACCCTCGTCACCATGTTCGGCAACAAGGGCCTGTCGGCGCGCGACATGACGGCGCTGTCGGGCGCGCAC
ACCGTCGGGCAGGCCCGGTGCACCACCTTCCGCAGCCGCATCTACGGCGACACCAACATCAACGCCACCTTCGCGTCGCTCCGGCAGCAGACGTGCCCGCAGGCCAGCGACGGCGGCGCC
GGCGACGCCGCGCTGGCGCCCATCGACGTCCGGACCCCCGAGGCGTTCGACAACGCCTACTACCAGAACCTGATGGCCAGGCAAGGGCTGTTCCACTCGGACCAGGAGCTCTTCAACGGC
GGCTCGCAGGACGCGCTGGTGAAGAAGTACAGCGGCAACGCCGCCATGTTCGCCGCCGACTTCGCCAAGGCGATGGTGAGGATGGGCGCCATCAGCCCGCTCACGGGGACGCAGGGCGAG
GTCAGGCTCGACTGCAGGAAGGTCAACTAG

Retrieve as FASTA