Entry information : SbPrx37 (Sobic.002G391400.1 [2.1] / Sb02g040680 [1.4])
Entry ID 843
Creation 2005-12-16 (Christophe Dunand)
Last sequence changes 2005-12-16 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx37 (Sobic.002G391400.1 [2.1] / Sb02g040680 [1.4])
Name (synonym) SbPrx37 (Sobic.002G391400.1 [2.1] / Sb02g040680 [1.4])
Class Class III peroxidase    [Orthogroup: Prx095]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Roots
Inducers Acid treatment
Alkaline treatment
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx37
start..stop
S start..stop
SbPrx36 602 0 1..364 1..368
ZmPrx30 597 0 1..364 1..390
ZmPrx97 593 0 2..365 1..350
ZmPrx09 592 0 2..365 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 74581815..74582132 318 N° 2 74580897..74581676 780  
complement(join(74580897..74581676,74581815..74582132))


exon

Literature and cross-references SbPrx37 (Sobic.002G391400.1 [2.1] / Sb02g040680 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_2 (74582132..74580897)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.35034.1
Protein sequence: SbPrx37 (Sobic.002G391400.1 [2.1] / Sb02g040680 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (343)
PWM (Da):   %s   39017.2 (36742.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.5 (6.24) Peptide Signal:   %s   cut: 23 range:23-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMSPNKLAVLTVIFAVLGSVTCQGGGYYSSPPPPPTTPSPPVYHYPSPQPPPSPPTAGSQLIVGYYKNKCGAYVDVEAIVKKHVKATDAGMQAGLVRMFFHDCFIRGCDASVLLDTFSNDTSLTPEKFAVPNFPSLRGYEVIDAAKEEIEAACPGKVSCADIIAFAARDASYFLSGGGINFAMPAGRYDGNVSLASEALSNLPPPFGGFDQLVKMFAAKGLDAFDMVTLSGAHSIGRSHCSSFTRDRLPPSNTSDMDPAFAATLQADCASADGTDNTVMQDFQTPDVLDNQYYKNVLAHKVLFTSDAALTTDFMAKNLVRAYADFVPYLWQNKFGKAMVKMGGIEVKTAANGEIRKTCRKINSRS*

Retrieve as FASTA  
Remarks Complete sequence from 16 ESTs and Genomic DNA (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGCCCTAATAAGCTCGCCGTCCTCACTGTCATCTTCGCCGTGCTCGGCTCCGTGACTTGCCAGGGCGGAGGCTACTACTCATCCCCGCCTCCGCCTCCGACTACACCATCACCA
CCCGTTTACCACTACCCATCCCCGCAACCACCACCAAGCCCTCCTACTGCAGGGTCCCAACTCATAGTCGGGTATTACAAGAACAAATGTGGCGCTTACGTGGATGTGGAGGCCATTGTC
AAGAAGCACGTCAAGGCCACTGATGCTGGCATGCAGGCAGGCCTTGTCCGTATGTTCTTCCACGACTGCTTCATCCGT
GTAAGACTAATAACACAATTCTTCGTTCTCCACTGATCAAGC
TAGCTAGAGCCATGCATGCATGCCCTACATAAGTACACAAATATTATGCATGCGATATTGCGATGTGTGACAACTAATGACATGTTTCATCTGCAGGGATGCGACGCCTCCGTCCTCCTG
GACACGTTCAGCAACGACACCAGCCTAACCCCGGAGAAGTTCGCCGTGCCCAACTTCCCCAGCCTACGGGGCTACGAGGTGATCGACGCGGCCAAGGAGGAGATCGAGGCGGCATGCCCT
GGCAAGGTCTCGTGCGCGGACATCATCGCGTTCGCCGCCCGCGACGCGTCCTACTTCCTCAGCGGCGGCGGCATCAACTTCGCCATGCCCGCCGGCCGCTATGACGGCAACGTGTCCCTC
GCCAGCGAGGCCCTGTCGAACCTGCCCCCGCCGTTCGGCGGCTTCGACCAGCTCGTCAAGATGTTCGCCGCCAAGGGCCTCGACGCCTTCGACATGGTCACGCTCTCCGGCGCGCACAGT
ATCGGCCGCTCCCACTGCTCCTCCTTCACCAGGGACCGCCTCCCGCCCAGCAACACCTCCGACATGGACCCGGCGTTCGCCGCCACGCTGCAGGCTGACTGCGCGTCGGCCGACGGCACC
GACAACACGGTGATGCAGGACTTCCAGACCCCCGACGTCCTGGACAACCAGTACTATAAGAACGTGCTGGCGCACAAGGTTCTCTTCACATCGGACGCGGCGCTCACCACCGACTTCATG
GCCAAAAACCTGGTGCGCGCTTACGCGGATTTCGTCCCCTATTTGTGGCAGAATAAGTTCGGCAAAGCCATGGTGAAGATGGGCGGCATTGAGGTCAAGACCGCCGCCAACGGGGAGATC
AGGAAGACGTGCCGTAAAATCAACAGCAGGTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGCCCTAATAAGCTCGCCGTCCTCACTGTCATCTTCGCCGTGCTCGGCTCCGTGACTTGCCAGGGCGGAGGCTACTACTCATCCCCGCCTCCGCCTCCGACTACACCATCACCA
CCCGTTTACCACTACCCATCCCCGCAACCACCACCAAGCCCTCCTACTGCAGGGTCCCAACTCATAGTCGGGTATTACAAGAACAAATGTGGCGCTTACGTGGATGTGGAGGCCATTGTC
AAGAAGCACGTCAAGGCCACTGATGCTGGCATGCAGGCAGGCCTTGTCCGTATGTTCTTCCACGACTGCTTCATCCGT
GGATGCGACGCCTCCGTCCTCCTGGACACGTTCAGCAACGAC
ACCAGCCTAACCCCGGAGAAGTTCGCCGTGCCCAACTTCCCCAGCCTACGGGGCTACGAGGTGATCGACGCGGCCAAGGAGGAGATCGAGGCGGCATGCCCTGGCAAGGTCTCGTGCGCG
GACATCATCGCGTTCGCCGCCCGCGACGCGTCCTACTTCCTCAGCGGCGGCGGCATCAACTTCGCCATGCCCGCCGGCCGCTATGACGGCAACGTGTCCCTCGCCAGCGAGGCCCTGTCG
AACCTGCCCCCGCCGTTCGGCGGCTTCGACCAGCTCGTCAAGATGTTCGCCGCCAAGGGCCTCGACGCCTTCGACATGGTCACGCTCTCCGGCGCGCACAGTATCGGCCGCTCCCACTGC
TCCTCCTTCACCAGGGACCGCCTCCCGCCCAGCAACACCTCCGACATGGACCCGGCGTTCGCCGCCACGCTGCAGGCTGACTGCGCGTCGGCCGACGGCACCGACAACACGGTGATGCAG
GACTTCCAGACCCCCGACGTCCTGGACAACCAGTACTATAAGAACGTGCTGGCGCACAAGGTTCTCTTCACATCGGACGCGGCGCTCACCACCGACTTCATGGCCAAAAACCTGGTGCGC
GCTTACGCGGATTTCGTCCCCTATTTGTGGCAGAATAAGTTCGGCAAAGCCATGGTGAAGATGGGCGGCATTGAGGTCAAGACCGCCGCCAACGGGGAGATCAGGAAGACGTGCCGTAAA
ATCAACAGCAGGTCGTGA

Retrieve as FASTA