Entry information : EglAPx[P]05
Entry ID 8445
Creation 2011-08-02 (Christophe Dunand)
Last sequence changes 2011-08-02 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2013-02-06 (Qiang Li)
Peroxidase information: EglAPx[P]05
Name EglAPx[P]05
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglAPx[P]05
start..stop
S start..stop
EcamAPx[P]05 147 8e-49 1..71 8..78
EgrAPx[P]02 147 8e-49 1..71 8..78
EguAPx[P]05 148 1e-48 1..71 8..78
EguAPx[P]02 145 4e-48 1..71 8..78
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22..51 30 N° 2 138..217 80 N° 3 307..409 103  
join(22..51,138..217,307..409)


exon

Literature and cross-references EglAPx[P]05
Protein sequence: EglAPx[P]05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   71
PWM (Da):   %s   7812.05  
PI (pH):   %s   4.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
IVALSGAHTLGRAHQERSGFDGPWTQEPLKFDNSYFVELLKGEAEGLLKLPTDKALLENPAFRPYVELYA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATAGTGGCCTTATCAGGGGCTCATACACTGGTAATTTCTATTTCTGCTTGGATTTACATTCAAGGTCAGCTGGGGATGCGTAACCACACTNNNNAATTTTTTATTCTTGTGTCTAGGGAA
GGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAATTCCTATTTTGT
GTAAGATTTCATCTTTTCACTGGATGCATTTTCTAAGTTTCGGC
TGGAGCATTATAGAGCCAGATACTAATTGATCATTTTTGACACAGCGAGTTGTTGAAAGGGGAAGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGCATTGCTGGAAAATCCTGCATT
TCGCCCTTATGTTGAGTTGTATGCGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATAGTGGCCTTATCAGGGGCTCATACACTGGGAAGGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAATTCCTATTTTGTCGAGTTGTTG
AAAGGGGAAGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGCATTGCTGGAAAATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAG

Retrieve as FASTA