Entry information : AcoAPx-R (AcoGoldSmith_v1.008273m)
Entry ID 8448
Creation 2011-08-09 (Bruno Savelli)
Last sequence changes 2011-10-03 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoAPx-R (AcoGoldSmith_v1.008273m)
Name (synonym) AcoAPx-R (AcoGoldSmith_v1.008273m)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoAPx-R
start..stop
S start..stop
AfpAPx-R 649 0 2..330 1..332
VvAPx-R 416 3e-147 4..330 5..330
GhAPx-R 414 5e-146 49..329 46..333
PtAPx-R 412 2e-145 23..330 27..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 957340..957529 190 N° 2 957091..957190 100 N° 3 956884..956999 116 N° 4 956387..956457 71
N° 5 956252..956294 43 N° 6 956067..956163 97 N° 7 955677..955760 84 N° 8 955371..955492 122
N° 9 954971..955037 67 N° 10 954025..954127 103  
complement(join(954025..954127,954971..955037,955371..955492,955677..955760,9560 67..956163,956252..956294,956387..956457,956884..956999,957091..957190,957340..9 57529))


exon

Literature and cross-references AcoAPx-R (AcoGoldSmith_v1.008273m)
DNA ref. Phytozome 12:   scaffold_20 (957529..954025)
Protein sequence: AcoAPx-R (AcoGoldSmith_v1.008273m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331
PWM (Da):   %s   35570.95  
PI (pH):   %s   5.5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMNGLDPSSICLVNSFSSSFSVKFKLPAKDATTKPSPFKYGGKVIKADAAASSTPSSCNNNDPYCRALNTRRGLLFTATLPFLVGMSESIDDVNAAVTYQTLQEGIKKVVSKGKAAGLLRLVFHDAGTFDKSDNSGGMNGSIVYELDRPENAGLKKSVKILEKARSELDEREQVSWADMIAVAGAEAVSVCGGPVIPVQLGRVDSMVPDPEGKLPEESLDAFGLKQCFLGKGFSTQELVALSGAHTLGSKGFGNPIAFDNTYFKILLEKPWLSSAGMSNMVGLPSDRALPEDDECLRWIKIYADDQNTFFEDFKNAYIKLVNSGVSWKTI*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAACGGTTTAGATCCTTCGTCAATCTGCTTAGTCAATTCTTTCTCTTCTTCCTTTTCCGTCAAATTTAAATTGCCCGCCAAAGATGCAACAACGAAACCCTCTCCGTTCAAATAT
GGCGGGAAAGTTATCAAAGCTGATGCTGCTGCTTCTTCCACCCCTTCTAGCTGCAATAATAATGACCCAT
GTATAGTAACTCGTCATTTTCATAATTTTATTTAATTTGTAATTCAAGTA
AAGTTAGGATCTTTGGTTTAAACCAAGGTCGGACTCGGTTCAATAGTTTGGCATTTCTTGATGATAATTATTACTTGGAAGTTATTTTGAATTTTGTAGATTGTCGCGCTTTAAACACAA
GAAGAGGACTTCTTTTTACAGCAACATTACCATTTCTTGTTGGAATGAGTGAATCCATTGATGATGTAAATGCCGCTGT
GTAAGTTCAAGTATCAGGTTTACATAAATTCTAGTATATTT
TTTGTTTGCTGACTGGACACTGATTTGGTGAGTTTCTTTCCAATTTCTAGTACATATCAAACTTTACAGGAAGGAATAAAGAAGGTAGTGTCTAAAGGAAAGGCTGCTGGTTTACTTCGT
CTTGTTTTTCATGATGCGGGAACGTTTGACAAGAGTGATAATTCAG
GTGACATTATTGAATGATTTGATGTTCCCAAGTTTATATATAATCTGATATAATTTGTATAGTGCTTCTTGCAA
GTATAAGCGTACTTATATTAGCCACCAACTCAGTGATTTGTCAAGGGTGTCAACGTAGAAACTTTCTATACAACTGATACATCACTTTTGCATAGTCTTAACAAATTAGTTTTGATTCAC
AAGTCTTAAGTGAACACATGATCAATACATCTGTTTCTTCCTTTGTCCCTCTTCTCCATTCATCCATTCTTCCTAGACTTGGTTAATTTTGATAATTAAACTCTATTTAATCTCTCGTAT
ATTGTCAGCAGGCTGCAGGCCAGCCTAACTAGTAACTACTGTTATTATGAAGAGTTTATTAATGTATGCTACCTCTCTAAAAATGTTACTCTACTTGATTATCATCTTATAGGTGGTATG
AATGGTTCCATAGTTTATGAACTTGACAGACCAGAAAATGCAGGTCTTAAGAAATCTGTAAAG
GTAAGTTCTATCTCTCTCTATATAAGGTTCCACTATCAAATGATGTTGGCTTGATTA
CCAACCACCTAATTCAAGATATGCATTGTCTTCAGATTCTAGAGAAAGCGAGAAGCGAACTAGATGAAAGAGAACAAGGTAACTGAACTGAGACTGTTAAAGGATGTTTAAGTATAAAGA
ATATAAATTTTATATCCTAACACATGGCTGGAATTCTACATATTAGTTTCATGGGCAGACATGATTGCAGTTGCCGGTGCCGAAGCAGTTTCTGTATGTGGGGGTCCAGTAATTCCAGTC
CAGTTGGGCAGAGTCGATTCTAT
GTAAGAAGCTACTTTCAGTATCTTAAGTTGCAATAACTTTAAATGAACCTCAGACTCCTAGAGCTGAATTCAGCTTGGATCAATCATAAGTAATACT
TGAAATGAATGCTACTGGTTCACTGTTTTACAAGAGTATCCTGTAATATTCTGGGTTTTTAGGTCATGGAAAACCAATTAAATTTTGATTTAGAGAAGTCTTGCTATCAACTTGAAGTCA
GCACAATATAGTTCTTTATTCCATGTTTTGTCATTTGCAGACTACAATATTCTATGCTGCAAATTCTGAGGATTAATTTTCCCTGGTAGGGTGCCTGATCCTGAAGGTAAACTTCCTGAA
GAATCTTTGGATGCATTTGGATTAAAACAGTGCTTTCTGGGAAAAGGCTTCTC
GTGAGTTCCTTCGTACCATTTCATTAGTTCAATGTCTCTTGAATCAAGTCCTTATGTATGGTTTTGT
CCTCATCATCTGTGCATACTTCATAGCATGCCTTACAAATAAAACTCAATGACATATCTTCCTGTCCTGGTTTCAATGATTACCTTCTTTCATCATAATGTAATTCTCGCTGTGCAGCAC
ACAAGAACTTGTCGCCTTGTCTGGAGCTCATACTCTTGGGAGTAAAGGATTTGGAAATCCGATTGCTTTTGACAATACCTACTTTAAAATTCTCTTGGAAAAGCCATGGCTATCTTCAG
G
TGAATATTTTGTTGGTTTCATTATTTAAGAACTTGATCCGAGTGAGAATTTTTTTTTTTTTTTGATAATTACCGTGTTAGTGCTCTCTAGCCACATCTACCTGACGTCAAAAGTGATTAG
TAAGTAAAACATATGGGACAGAATGGAAGGACAGCTTCATCCTCAAACATATATGGACTCTCTATTTCTTCCCCCTTTCCAGAGATTTTTGGTTATTGCAACTGGAAAGATAGCTGCTAA
ACGAACGTCTTCCTCTCGCAATTTGTACACCTACTGGTTTATTTGGTTTGAATTATCATATGTTATATATATTCTTTTTGTTTCGCCTGCAGCTGGTATGTCAAATATGGTTGGACTTCC
ATCAGATCGTGCACTCCCTGAAGATGATGAATGCTTAAG
GTTCTTCCACCAAATCTTAACACAAATCATCAAAATCTGTCCACACACACTCACACACCTTTTGTTTCTATGTATAAGAAT
GTGAGGTATTACTTATACTTACATTCATAAAAATTTGCTTGATACCCTCCTTGAAGCACATGCACATTGGATTTTTTATTTTTTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTATTTTTTATAGTACATGCACATTGGATTAGAAAATGTATGATGAGTTTTTATCAATGGGATCAAAAGGAACCATCCCAACTGC
ACAAGGGACTGCCATATTGTCTAAAAGTAACTAAAGCGATAAGGGACTGCCATATCTTCATAGGGTTTACTTACATCTTCCCTGATTTCGTGTTGTCGTGGCAATAAAGAGAGGCACTTA
TTTATGTTTTTGAAGTGGGCTGCTAGCATTTACGGCTCACAGACAGCAGAAGTGTTGCCAGGTGTCATTTGACACTGATATTACTCATGTCCTATATATAATTGGTTTCCAATTATGGCA
AATATGTTCCAAACAATGTAAATTGAACTAATGCATGTTGTCAGTGGGATGTTGAATTGTTTTATGATTGCCAAAGGATAAACTTCATGCCATCTGATTTTTTTAAAGTTACTTCCAAAA
TTGCATTGTTCCAACATGCTTAAGTGATGATAACATATGCAGGTGGATCAAAATATATGCTGATGATCAGAACACATTCTTTGAAGATTTTAAGAATGCTTATATCAAACTCGTCAATTC
TGGGGTGTCGTGGAAGACTATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAACGGTTTAGATCCTTCGTCAATCTGCTTAGTCAATTCTTTCTCTTCTTCCTTTTCCGTCAAATTTAAATTGCCCGCCAAAGATGCAACAACGAAACCCTCTCCGTTCAAATAT
GGCGGGAAAGTTATCAAAGCTGATGCTGCTGCTTCTTCCACCCCTTCTAGCTGCAATAATAATGACCCAT
ATTGTCGCGCTTTAAACACAAGAAGAGGACTTCTTTTTACAGCAACATTA
CCATTTCTTGTTGGAATGAGTGAATCCATTGATGATGTAAATGCCGCTGT
TACATATCAAACTTTACAGGAAGGAATAAAGAAGGTAGTGTCTAAAGGAAAGGCTGCTGGTTTACTTCGT
CTTGTTTTTCATGATGCGGGAACGTTTGACAAGAGTGATAATTCAG
GTGGTATGAATGGTTCCATAGTTTATGAACTTGACAGACCAGAAAATGCAGGTCTTAAGAAATCTGTAAAGATT
CTAGAGAAAGCGAGAAGCGAACTAGATGAAAGAGAACAAG
TTTCATGGGCAGACATGATTGCAGTTGCCGGTGCCGAAGCAGTTTCTGTATGTGGGGGTCCAGTAATTCCAGTCCAGTTG
GGCAGAGTCGATTCTAT
GGTGCCTGATCCTGAAGGTAAACTTCCTGAAGAATCTTTGGATGCATTTGGATTAAAACAGTGCTTTCTGGGAAAAGGCTTCTCCACACAAGAACTTGTCGCC
TTGTCTGGAGCTCATACTCTTGGGAGTAAAGGATTTGGAAATCCGATTGCTTTTGACAATACCTACTTTAAAATTCTCTTGGAAAAGCCATGGCTATCTTCAG
CTGGTATGTCAAATATG
GTTGGACTTCCATCAGATCGTGCACTCCCTGAAGATGATGAATGCTTAAG
GTGGATCAAAATATATGCTGATGATCAGAACACATTCTTTGAAGATTTTAAGAATGCTTATATCAAACTC
GTCAATTCTGGGGTGTCGTGGAAGACTATCTGA

Retrieve as FASTA