Entry information : AcoPrx07 (AcoGoldSmith_v1.007025m)
Entry ID 8451
Creation 2011-08-09 (Bruno Savelli)
Last sequence changes 2011-09-28 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-07 (Achraf Jemmat)
Peroxidase information: AcoPrx07 (AcoGoldSmith_v1.007025m)
Name (synonym) AcoPrx07 (AcoGoldSmith_v1.007025m)
Class Class III peroxidase    [Orthogroup: Prx116]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx07
start..stop
S start..stop
AcoPrx10 574 0 2..352 3..352
AcoPrx46 572 0 2..352 3..352
AfpPrx15 570 0 2..352 3..352
AfpPrx17 523 0 25..353 20..345
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6368..6613 246 N° 2 6955..7155 201 N° 3 7257..7919 663  
join(6368..6613,6955..7155,7257..7919)


exon

Literature and cross-references AcoPrx07 (AcoGoldSmith_v1.007025m)
DNA ref. Phytozome 12:   scaffold_114 (6368..7919)
Protein sequence: AcoPrx07 (AcoGoldSmith_v1.007025m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   370 (342)
PWM (Da):   %s   39745.91 (36776.4)  
PI (pH):   %s   5.33 (5.34) Peptide Signal:   %s   cut: 28 range:28-369
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSSASFFSLLLLSSLLFDSHLSLTSAQATPPLLAGLSYEFHSTNCPSLETTIRDYLREILSSDTGVAAGLLRVHFHDCFVQGCDGSVLLAGSASGPGQGEQQAPPNLTLRARAFVIIEELRNRIHRACGAIVSCSDIAALSARDAVFLSGGPDYRVPLGRRDGLSFATVNATLANLPFFGSRVPQLITDFAAKNLDVNDLVALSGGHTIGRGNCGSFVGRLYPTRDPTLETTFADNLTRVCPTNTSSGVTPLDVRTPNNFDNQYYVDLLNRQGLFTSDQDLFTDNTTAPIVTSFANNQTLFFERFAFSMIKMGMINVTTGTQGEIRTNCSARNAASTTYLTTDVDQQGKNAGILRLFDNVVEGLFGYI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCTCTGCTTCATTCTTCTCCCTTCTGTTATTATCTTCTCTTCTTTTTGACTCCCATTTGTCTCTTACAAGTGCACAAGCAACACCTCCTTTGCTTGCAGGACTTTCATATGAG
TTCCATAGCACCAACTGTCCATCTTTAGAAACCACTATTAGAGACTACCTTAGGGAAATCTTAAGCAGTGATACCGGTGTTGCTGCAGGCTTGCTTCGTGTTCATTTCCATGATTGTTTT
GTCCAG
GTACTTTAGCTATCATTAATTCATCATTTGTTTTTGCTTCCATGTTAATTTTCAAATATGTTTCTAGCAACTAGTACTACTGCACATACTTGTGTTAGGAAAAAAAAAAAAAAT
TCTGTATATGAATTTTGCTGTTGGATTTTGATATAGTAGTTGGTCGGTTGGTCCACATCAACGAACCAAGTATATAAGTTTAAGCTGAAATTTAACTAAAATTTCCACTAGTTGACTGCT
TTGATGTCTTGATTAATTTATATTCATATATAATACTATATATTTGATATAGTCCTATCTCTGTCATATCATGTTCATGTTTGTTGTTGTTGTTGGTGTGTATGTAGGGATGTGATGGCT
CAGTGCTGCTTGCTGGGTCTGCGAGTGGTCCTGGTCAAGGTGAACAACAGGCACCACCAAACTTGACACTCAGAGCACGAGCATTTGTTATTATTGAGGAACTTCGTAACCGCATCCATA
GAGCTTGTGGTGCAATTGTTTCTTGCTCTGATATTGCTGCGCTTAGTGCTCGTGACGCTGTTTTCTTG
GTAATTTTTCATAACCAACTTTGTCCATTCATTTATGACAACCATTTGGAAA
GAGTTAATCATTTGATGATGAGCAATAAAATTGATTTGTATTCATGCAGTCCGGTGGTCCAGATTACCGAGTTCCTCTAGGTAGGCGTGATGGTCTCAGCTTCGCCACTGTAAATGCAAC
ACTAGCCAACCTTCCATTCTTCGGTTCAAGGGTACCACAGCTTATTACAGACTTCGCTGCCAAGAACTTGGACGTAAATGATCTCGTTGCACTCTCTGGTGGCCATACCATTGGCCGTGG
AAACTGCGGGTCCTTTGTAGGACGCTTATACCCTACCCGAGACCCAACTCTGGAGACAACCTTCGCAGATAACCTTACACGTGTTTGCCCCACAAATACTTCTTCTGGAGTCACTCCTTT
GGATGTTCGAACTCCAAATAACTTTGACAATCAATACTACGTTGATCTTCTCAATCGACAAGGTCTATTCACCTCCGACCAAGACTTGTTCACTGATAATACTACTGCACCAATTGTCAC
AAGCTTTGCTAATAACCAAACTTTGTTCTTCGAAAGGTTTGCATTTTCCATGATTAAAATGGGTATGATAAATGTTACTACTGGAACACAAGGTGAAATACGTACCAATTGCTCAGCTCG
CAATGCTGCTTCTACGACTTATTTGACAACTGATGTGGATCAACAAGGGAAGAATGCAGGAATACTAAGGTTGTTTGATAATGTTGTGGAAGGTTTGTTTGGATATATATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCTCTGCTTCATTCTTCTCCCTTCTGTTATTATCTTCTCTTCTTTTTGACTCCCATTTGTCTCTTACAAGTGCACAAGCAACACCTCCTTTGCTTGCAGGACTTTCATATGAG
TTCCATAGCACCAACTGTCCATCTTTAGAAACCACTATTAGAGACTACCTTAGGGAAATCTTAAGCAGTGATACCGGTGTTGCTGCAGGCTTGCTTCGTGTTCATTTCCATGATTGTTTT
GTCCAG
GGATGTGATGGCTCAGTGCTGCTTGCTGGGTCTGCGAGTGGTCCTGGTCAAGGTGAACAACAGGCACCACCAAACTTGACACTCAGAGCACGAGCATTTGTTATTATTGAGGAA
CTTCGTAACCGCATCCATAGAGCTTGTGGTGCAATTGTTTCTTGCTCTGATATTGCTGCGCTTAGTGCTCGTGACGCTGTTTTCTTG
TCCGGTGGTCCAGATTACCGAGTTCCTCTAGGT
AGGCGTGATGGTCTCAGCTTCGCCACTGTAAATGCAACACTAGCCAACCTTCCATTCTTCGGTTCAAGGGTACCACAGCTTATTACAGACTTCGCTGCCAAGAACTTGGACGTAAATGAT
CTCGTTGCACTCTCTGGTGGCCATACCATTGGCCGTGGAAACTGCGGGTCCTTTGTAGGACGCTTATACCCTACCCGAGACCCAACTCTGGAGACAACCTTCGCAGATAACCTTACACGT
GTTTGCCCCACAAATACTTCTTCTGGAGTCACTCCTTTGGATGTTCGAACTCCAAATAACTTTGACAATCAATACTACGTTGATCTTCTCAATCGACAAGGTCTATTCACCTCCGACCAA
GACTTGTTCACTGATAATACTACTGCACCAATTGTCACAAGCTTTGCTAATAACCAAACTTTGTTCTTCGAAAGGTTTGCATTTTCCATGATTAAAATGGGTATGATAAATGTTACTACT
GGAACACAAGGTGAAATACGTACCAATTGCTCAGCTCGCAATGCTGCTTCTACGACTTATTTGACAACTGATGTGGATCAACAAGGGAAGAATGCAGGAATACTAAGGTTGTTTGATAAT
GTTGTGGAAGGTTTGTTTGGATATATATAA

Retrieve as FASTA