Entry information : AcoPrx19 (AcoGoldSmith_v1.008155m / Aquca_010_00140)
Entry ID 8453
Creation 2011-08-09 (Bruno Savelli)
Last sequence changes 2011-10-03 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-04-10 (Christophe Dunand)
Peroxidase information: AcoPrx19 (AcoGoldSmith_v1.008155m / Aquca_010_00140)
Name (synonym) AcoPrx19 (AcoGoldSmith_v1.008155m / Aquca_010_00140)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx19
start..stop
S start..stop
NtPrx08-1B 495 4e-178 1..323 1..321
PtPrx59 490 2e-176 10..326 5..324
InPrx03 487 5e-175 6..323 1..320
GrPrx17 486 9e-175 11..327 7..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 871752..871961 210 N° 2 871473..871664 192 N° 3 870759..871361 603  
complement(join(870759..871361,871473..871664,871752..871961))


exon

Literature and cross-references AcoPrx19 (AcoGoldSmith_v1.008155m / Aquca_010_00140)
DNA ref. Phytozome 12:   scaffold_10 (871961..870759)
Protein sequence: AcoPrx19 (AcoGoldSmith_v1.008155m / Aquca_010_00140)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (312)
PWM (Da):   %s   37125.37 (34432.0)  
PI (pH):   %s   4.66 (4.60) Peptide Signal:   %s   cut: 23 range:23-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSTHLFFVLVTFFLNISITFSTQLRPGFYEQTCPKAEEIVKDVMLESMMRDRRSAASVMRLQFHDCFVNGCDASLLLDDTPNMLGEKLSLSNIDSLRSYEVVDEIKEALENFCPGVVSCADIIIMASRDAVTLSGGPNWEVKLGRKDSLTASQADSDKVMPSPRANATALIDLFSTFYLSIKDMVALSGSHSIGNGRCFSIIFRLYNQSGTGLPDPTIEPEFREKLDRLCPDGGDLEVIGNLDATPFKFDNQYFKDLVNGRGFLNSDQTLYSLDPRSREFVVQFSKDQGAFFAAFVEGMLKMGDIQSGRPGEIRRNCREVNAGSIEQGFVKSF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAGGAAATT CACTCTCTTC TTGATAAGCT CCCACCAGAG ACAATCATGC TGGATCCCAC ACAGATTGGT ACATTAAGAC CGCCGAGAGC AAAAGAACAA CTGACTAAAC AGGAAAGAGA  AGCTGCGATG GAGGCTGCCA TTGAATCTGC GAAGCAGGGT TCCAATAAGA AGAAAACAAA AGGAAGGAGC AAACCAACTA GAATGCAGAA GAAGAAGCAA GATGGCATAG TGAAAGCCAA  GAGGCCTTTC TTGGATCAAC AATTGAAGGA GGAGCGACAA TTATTAAATA AAAAGCCAAA ACTGAATGAG GAAGTTCAGT TGCCACTATC TCTTCAGCGA TTTGCCCGCA AGAAGGCTAC  GTGAATTTTC CTCATACTCC GAAATTTGAT GCATGTATGT TACTTGTTTT AACAGTGGCG GATCCTGTTA CTACATTGAT GGAACTGCAT TGACACACAA AGCTTGCCTT AGACTGCGGG  ATTTTGTTAT GGCGGGACTC AAGGTCACAA GTATACAGCC TAGGTAGGGA AGGTATCATA CAACCCAAGA TGCTGATTGT GTTCATCTAG TGGCTGAATT ATTTCGTTTC GGTTTGCTTA  ATTGCTGCAC CAAGAATTTT GTATTAATTT TGCAACTGGG CTCTCTTGAC TTACGATTTA AGTATATGTT GTAAACTTCA GAAAGTCGAT TCTGGCAGGT AACTCAGTCC TCACTAAAGA  AAGTCTGCTT TGTAAATTGA TATTGTTGAG AAACATGATA GTCAACATTT TGTGGAAGTT GGTATCATTT TGAAGCTTTT ACATGTTCAT GAATGTTTCT GAAAAGTTTT ATTTCTCTAA  TATTTTAGCT TAAACTCTAG GTTTTCCGAT TCCACTGAAC AAAAATCTCT TGTTCAGAAT TTTCAACATT TCCCTGGACA GGGACCCTCG ACGCCTCATA ATAATTGGGC AATGATGACT  TTTCTGTACC AGAATGCCTG CAGCTCTTTG TGCTTTTAAG TTAAGTGATA TGATGATAAA GATAAGGTTT CTTTCTTTCA TCCAATGTCA ACTTACATAT GTGAGGGTTA TATTATGTTG  TTTTGAAGCT TACATATGTT GTGCAACAAA GATAAGGTTT ATTCCACATT AACATAGACT ACCCATTCAT GATTAATGAG TAAGGTACTA TGGTGGTCAA AGAAGCAGCT TGTGCTATAA  GTTCTGTACC ATTCTAGAAA ACAACTTCAG AGATTCAATT CAGAATTGTC TCTATCTATC CATGGCACTT AGTGCGTCTA ACTCAAGCTT TAACAACAGC TTCTTATAGT GGGGGACCTG  TAGCTGATGC CTTCTATAAA AGAAGTTTTT GTTATCATGG ACCACATAAG CAGGTGAGCA CCACCATCCC ATTCGAGTTA CATGGTCCCG TTCCCGCAGT TGTGACCCAA TACTGGCAGT  GGTGGTAGGG TTTGTGAACT AAAATTCGCG GTGTTTAGGT CGGCTCCATT TCTAAGGGTA TGTTCCAGCT GACTTTGTTG GTAAACATGG TTACTAGCTC AGTTGATCAG TACATATATC  AGCCTTGATT AGCTACTTGA CATTGTATCT GATGGTTATA ATGTTCCAGA TCACTTGGTT GCTCAATACC AGCGCAGACA CACTGGAGCA TTGAAATACT TGCCCTGTAA ATATGACGTT  AACATTGAGC CAACAGGATC AATAGTTTGT ATTTTGTAAT TACTAGAACT GCCCATTGGT TCTTCAGAGT TTCTTCAAAT CAGACAAGAA GCCTTTGTAT TATCATGACA CCCGACCACC  TGACACACAT GCAAGATTCT CATGCCATGT GTTCATATCA TAACTCACAT ACATACCCAC TCACACATAC ATACATTACT GATCTCACCA TCCATATTCA TCTTATATAA TTAAGTCTAC 
AAATCCATCC CTTTTTTCAC ACTGACTTCA ATACTCATTA AGCATCACTC ACTCACTGAA ATAAAACACT CAACAACAAC T 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCACACATCTTTTCTTTGTGCTTGTTACCTTCTTCCTTAACATATCCATAACCTTTTCAACCCAATTAAGACCTGGTTTTTATGAACAAACATGCCCAAAAGCAGAAGAAATA
GTAAAAGATGTTATGTTGGAATCCATGATGAGAGACAGAAGAAGTGCTGCATCAGTTATGCGTTTGCAATTTCATGATTGCTTTGTTAAC
GTAAGTTTGTTCTAATCTTTATTAATTTCT
TCATCGTCTTCACTTATATAAAATAAAATAGTTTAATGTTGTTTTAATGTTTTATAGGGTTGTGATGCTTCTTTGTTACTAGATGATACACCTAATATGTTAGGTGAAAAGCTATCTCTA
TCAAATATAGATTCACTCAGATCATATGAAGTTGTAGATGAAATCAAGGAGGCTTTAGAGAATTTCTGCCCTGGTGTTGTTTCTTGCGCAGATATCATTATCATGGCTTCAAGAGATGCC
GTTACATTG
GTAATTAACATTAACATATATATTTTCTTATCCTTTAATTATATGGAATAATTAATTATTGATTAATCACATGATCATGACTAATAAGGCAGTTTTTGATTTTATTTTTAG

AGTGGAGGACCTAATTGGGAAGTGAAGTTAGGTCGGAAAGATAGCTTAACAGCAAGCCAAGCAGACTCAGACAAGGTCATGCCTAGTCCAAGAGCTAACGCGACTGCTCTGATCGACCTC
TTCAGCACTTTTTATCTCTCTATCAAGGACATGGTTGCGCTTTCCGGTTCTCATTCTATTGGTAATGGCAGATGTTTTTCTATAATTTTTCGCCTTTACAACCAGTCAGGTACAGGTCTT
CCTGACCCAACTATTGAGCCTGAATTTCGAGAAAAGTTAGACAGGCTATGTCCCGATGGTGGTGACCTGGAAGTAATTGGAAACCTTGATGCTACTCCATTTAAATTTGACAATCAATAC
TTCAAAGACTTGGTGAATGGTAGAGGTTTTCTTAACTCAGATCAGACACTTTACAGTTTGGATCCTAGGAGTCGAGAATTTGTTGTACAATTTAGTAAAGATCAAGGAGCGTTCTTTGCA
GCATTTGTGGAAGGGATGCTGAAGATGGGTGACATACAATCAGGCCGGCCAGGCGAGATCAGAAGGAACTGTAGGGAGGTTAATGCCGGATCGATAGAACAAGGTTTCGTTAAGAGCTTT
TAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCACACATCTTTTCTTTGTGCTTGTTACCTTCTTCCTTAACATATCCATAACCTTTTCAACCCAATTAAGACCTGGTTTTTATGAACAAACATGCCCAAAAGCAGAAGAAATA
GTAAAAGATGTTATGTTGGAATCCATGATGAGAGACAGAAGAAGTGCTGCATCAGTTATGCGTTTGCAATTTCATGATTGCTTTGTTAAC
GGTTGTGATGCTTCTTTGTTACTAGATGAT
ACACCTAATATGTTAGGTGAAAAGCTATCTCTATCAAATATAGATTCACTCAGATCATATGAAGTTGTAGATGAAATCAAGGAGGCTTTAGAGAATTTCTGCCCTGGTGTTGTTTCTTGC
GCAGATATCATTATCATGGCTTCAAGAGATGCCGTTACATTG
AGTGGAGGACCTAATTGGGAAGTGAAGTTAGGTCGGAAAGATAGCTTAACAGCAAGCCAAGCAGACTCAGACAAGGTC
ATGCCTAGTCCAAGAGCTAACGCGACTGCTCTGATCGACCTCTTCAGCACTTTTTATCTCTCTATCAAGGACATGGTTGCGCTTTCCGGTTCTCATTCTATTGGTAATGGCAGATGTTTT
TCTATAATTTTTCGCCTTTACAACCAGTCAGGTACAGGTCTTCCTGACCCAACTATTGAGCCTGAATTTCGAGAAAAGTTAGACAGGCTATGTCCCGATGGTGGTGACCTGGAAGTAATT
GGAAACCTTGATGCTACTCCATTTAAATTTGACAATCAATACTTCAAAGACTTGGTGAATGGTAGAGGTTTTCTTAACTCAGATCAGACACTTTACAGTTTGGATCCTAGGAGTCGAGAA
TTTGTTGTACAATTTAGTAAAGATCAAGGAGCGTTCTTTGCAGCATTTGTGGAAGGGATGCTGAAGATGGGTGACATACAATCAGGCCGGCCAGGCGAGATCAGAAGGAACTGTAGGGAG
GTTAATGCCGGATCGATAGAACAAGGTTTCGTTAAGAGCTTTTAG

Retrieve as FASTA