Entry information : AcoPrx15 (AcoGoldSmith_v1.007797m)
Entry ID 8454
Creation 2011-08-09 (Bruno Savelli)
Last sequence changes 2015-12-28 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-28 (Achraf Jemmat)
Peroxidase information: AcoPrx15 (AcoGoldSmith_v1.007797m)
Name (synonym) AcoPrx15 (AcoGoldSmith_v1.007797m)
Class Class III peroxidase    [Orthogroup: Prx116]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx15
start..stop
S start..stop
AfpPrx17 698 0 1..346 1..346
AcoPrx10 525 0 1..346 1..354
AcoPrx07 522 0 20..345 25..353
AfpPrx15 521 0 1..346 1..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3552856..3553086 231 N° 2 3553197..3553391 195 N° 3 3553534..3554148 615  
join(3552856..3553086,3553197..3553391,3553534..3554148)


exon

Literature and cross-references AcoPrx15 (AcoGoldSmith_v1.007797m)
DNA ref. Phytozome 12:   scaffold_23 (3552856..3554154)
Protein sequence: AcoPrx15 (AcoGoldSmith_v1.007797m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   347 (324)
PWM (Da):   %s   37713.12 (35302.8)  
PI (pH):   %s   6.76 (6.76) Peptide Signal:   %s   cut: 23 range:23-346
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNTSSASFISLLLVSSLLLTNAQTTPPLIRGLSFDFHRTNCPSLETTIRDYLREIFSSDFGMAPGLLRVHFHDCFVQGCDGSVLLAGSASGPAEQEAPPNLTLRPRAFVIINELRNRIHRACGAIVSCSDIAALCARDAVFLSGGPDYRVPLGRRDGVTLATVNATLDNLPFFGSSARELAAFFLNKGLDLNDLVALSGGHTFGRSNCASFVGRLYPTQDPTLDPIFAETLRRVCPSNTSSGVTPLDVRTPNIFDNQFYVALVNRQGLLNSDQDLFTDPTIRPIVTRFANNQTLFFERYVFSIIKMGMLNVLTGTQGQIRTDCSRRNTVTTHLTTGVDEQGESAAF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATACTTCTTCTGCTTCTTTCATATCCCTTCTTTTAGTTTCTTCTCTTCTTCTAACAAATGCACAAACTACACCTCCTTTAATAAGAGGACTTTCATTTGATTTCCATCGCACCAAC
TGTCCTTCTTTAGAAACCACTATTAGAGACTACCTTAGGGAGATCTTTAGTAGTGATTTTGGTATGGCTCCAGGTTTGCTTCGTGTTCATTTCCATGATTGCTTTGTCCAG
GTACTACTA
CGCTATTTATTTTTTCAAACTGATATGCATCATCATACCATGCCCAAAAAAGGCCAGATTGTATATTTTTGTAACATATGTTCTTGTATATATATCGATAGGGATGCGACGGCTCAGTGT
TGCTTGCTGGGTCAGCTAGTGGTCCTGCTGAACAGGAAGCACCACCAAATTTGACATTGAGGCCCCGAGCATTTGTTATCATCAATGAACTTCGTAACCGCATTCATAGAGCTTGCGGTG
CAATAGTCTCCTGCTCTGATATTGCTGCCCTTTGTGCTCGTGATGCCGTGTTTCTG
GTAACCCTCACAACTACTCTTCTTTCTCTTTATACCCTCAATGAAATGATATATAGCTGTGCTT
TCACTATGATGTACAGTATGTATTAATATAATTTCTATTATTTGATGGACAATAACTAGTAAATTTGTGCTCATGTAGTCTGGCGGTCCAGATTACCGAGTTCCATTAGGTAGGCGTGAT
GGAGTCACTCTCGCAACAGTAAATGCTACTCTAGACAACCTTCCGTTTTTTGGTTCATCTGCTAGGGAGCTCGCTGCATTTTTCCTCAACAAGGGTTTGGACTTAAATGATCTAGTTGCA
CTCTCTGGTGGCCATACCTTTGGCCGTAGCAATTGTGCTTCCTTTGTCGGACGCTTGTACCCCACCCAAGACCCAACACTAGACCCAATCTTTGCAGAAACCCTAAGGCGTGTTTGCCCT
TCAAATACTTCTTCTGGAGTCACTCCATTAGATGTTCGAACTCCAAATATATTTGACAATCAATTCTATGTTGCTCTTGTAAATCGACAAGGGCTCCTCAATTCTGATCAAGACTTGTTC
ACTGATCCAACTATTAGACCCATAGTCACCCGTTTTGCTAATAACCAAACTTTGTTTTTCGAGAGGTATGTGTTTTCCATTATTAAGATGGGCATGTTAAATGTGCTCACTGGTACACAA
GGTCAGATTCGTACTGATTGTTCTCGTCGCAACACTGTTACTACCCATTTGACTACTGGTGTGGATGAACAAGGGGAAAGTGCTGCATTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATACTTCTTCTGCTTCTTTCATATCCCTTCTTTTAGTTTCTTCTCTTCTTCTAACAAATGCACAAACTACACCTCCTTTAATAAGAGGACTTTCATTTGATTTCCATCGCACCAAC
TGTCCTTCTTTAGAAACCACTATTAGAGACTACCTTAGGGAGATCTTTAGTAGTGATTTTGGTATGGCTCCAGGTTTGCTTCGTGTTCATTTCCATGATTGCTTTGTCCAG
GGATGCGAC
GGCTCAGTGTTGCTTGCTGGGTCAGCTAGTGGTCCTGCTGAACAGGAAGCACCACCAAATTTGACATTGAGGCCCCGAGCATTTGTTATCATCAATGAACTTCGTAACCGCATTCATAGA
GCTTGCGGTGCAATAGTCTCCTGCTCTGATATTGCTGCCCTTTGTGCTCGTGATGCCGTGTTTCTG
TCTGGCGGTCCAGATTACCGAGTTCCATTAGGTAGGCGTGATGGAGTCACTCTC
GCAACAGTAAATGCTACTCTAGACAACCTTCCGTTTTTTGGTTCATCTGCTAGGGAGCTCGCTGCATTTTTCCTCAACAAGGGTTTGGACTTAAATGATCTAGTTGCACTCTCTGGTGGC
CATACCTTTGGCCGTAGCAATTGTGCTTCCTTTGTCGGACGCTTGTACCCCACCCAAGACCCAACACTAGACCCAATCTTTGCAGAAACCCTAAGGCGTGTTTGCCCTTCAAATACTTCT
TCTGGAGTCACTCCATTAGATGTTCGAACTCCAAATATATTTGACAATCAATTCTATGTTGCTCTTGTAAATCGACAAGGGCTCCTCAATTCTGATCAAGACTTGTTCACTGATCCAACT
ATTAGACCCATAGTCACCCGTTTTGCTAATAACCAAACTTTGTTTTTCGAGAGGTATGTGTTTTCCATTATTAAGATGGGCATGTTAAATGTGCTCACTGGTACACAAGGTCAGATTCGT
ACTGATTGTTCTCGTCGCAACACTGTTACTACCCATTTGACTACTGGTGTGGATGAACAAGGGGAAAGTGCTGCATTCTGA

Retrieve as FASTA