Entry information : SmaCcP
Entry ID 8457
Creation 2011-08-10 (Christophe Dunand)
Last sequence changes 2011-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-08-10 (Christophe Dunand)
Peroxidase information: SmaCcP
Name SmaCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Sordaria
Organism Sordaria macrospora    [TaxId: 5147 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmaCcP
start..stop
S start..stop
NcCcP 675 0 15..372 1..358
NtetCcP01 674 0 15..372 1..358
NdisCcP01 662 0 15..372 1..358
CgCcP 602 0 20..372 3..355
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 243307..243348 42 N° 2 242739..243228 490 N° 3 242091..242677 587  
complement(join(242091..242677,242739..243228,243307..243348))


exon

Literature and cross-references SmaCcP
Protein ref. UniProtKB_Uniparc:   D1ZQP5
DNA ref. GenBank:   CABT01000081.1 (243348..242091)
Protein sequence: SmaCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372
PWM (Da):   %s   41390.65  
PI (pH):   %s   8.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEFGDARDARSLPRMAASRTATRTLRALRTSTLPALTATPRAAFRQGGRRLYSSEPAKSGGSNIWAWAIGAGALGAGGLWYLNQDGASATPKVITPKFEDYQAVYNEIASRLEEKDDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKAKFPWITYSDLWILAGVCAIQEMQGPKIPYRPGRQDRDVAACTPDGRLPDASQAQDHLRNIFYRMGFNDQEIVALAGAHALGRCHTDRSGFDGPWTFSPTVMTNDYYKLLLDEKWQWKKWNGPKQYEDKKTKSLMMLPADMALIQDKTFKQWVQKYAANNELFFQDFSNVIVKLFELGVPFAENSERWVFKPVNA

Retrieve as FASTA  
Remarks complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTTCGGCGATGCCCGTGATGCGCGATCTCTTCCTCGCGTTCAACACCATCATATGGGACTCACCATGATAACAACAAGAGTAATGTTGATGCTAACAAATTCTCCCTCCACGTAG

ATGGCCGCCTCCCGCACTGCCACCCGCACTCTCCGCGCTCTGCGCACCTCGACTCTCCCTGCGCTCACTGCCACGCCCCGCGCTGCTTTCCGCCAGGGTGGTCGTCGCCTCTACTCTTCT
GAGCCCGCCAAGTCCGGTGGCTCCAACATTTGGGCCTGGGCTATCGGTGCTGGTGCTCTCGGTGCCGGTGGTCTCTGGTATCTCAACCAGGACGGCGCTTCCGCCACTCCCAAGGTTATC
ACTCCCAAGTTCGAGGACTACCAGGCCGTCTACAACGAGATTGCCTCCCGCCTCGAGGAGAAGGACGACTACGACGATGGCAGCTACGGCCCCGTCCTCGTCCGTCTCGCCTGGCACGCC
AGCGGCACCTATGACAAGGAGACCGGCACTGGTGGCTCCAACGGTGCCACCATGCGCTTCGCTCCCGAGTCTGACCACGGTGCCAACGCCGGCCTGAAGGCTGCTCGTGACTTCCTCGAG
CCCGTCAAGG
GTAAGCTACTACCATCTTATCTCTAATCGCGGGGTTTTCAACTTACTAACGCCCTGAACAGCCAAGTTCCCTTGGATCACCTACTCCGACCTCTGGATCCTTGCCGGTGT
CTGCGCCATCCAGGAGATGCAGGGCCCCAAGATCCCCTACCGCCCCGGTCGCCAGGACCGTGATGTCGCTGCCTGCACTCCCGACGGCCGTCTTCCTGATGCCTCCCAGGCCCAGGACCA
TCTCCGCAACATCTTCTACCGCATGGGCTTCAACGATCAGGAGATCGTTGCTCTTGCCGGTGCTCACGCTCTCGGCCGCTGTCACACCGACCGCTCCGGCTTCGACGGCCCCTGGACCTT
CTCCCCTACCGTCATGACCAACGACTACTACAAGCTCCTTCTCGACGAGAAGTGGCAGTGGAAGAAGTGGAACGGCCCCAAGCAGTATGAGGACAAGAAGACCAAGTCCCTCATGATGCT
TCCCGCCGACATGGCCCTCATCCAGGACAAGACTTTCAAGCAATGGGTTCAGAAGTACGCCGCCAACAACGAGCTCTTCTTCCAGGACTTCTCCAACGTCATTGTCAAGCTCTTCGAGCT
CGGCGTTCCCTTCGCCGAGAACTCCGAGCGCTGGGTCTTCAAGCCCGTCAACGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTTCGGCGATGCCCGTGATGCGCGATCTCTTCCTCGCATGGCCGCCTCCCGCACTGCCACCCGCACTCTCCGCGCTCTGCGCACCTCGACTCTCCCTGCGCTCACTGCCACGCCC
CGCGCTGCTTTCCGCCAGGGTGGTCGTCGCCTCTACTCTTCTGAGCCCGCCAAGTCCGGTGGCTCCAACATTTGGGCCTGGGCTATCGGTGCTGGTGCTCTCGGTGCCGGTGGTCTCTGG
TATCTCAACCAGGACGGCGCTTCCGCCACTCCCAAGGTTATCACTCCCAAGTTCGAGGACTACCAGGCCGTCTACAACGAGATTGCCTCCCGCCTCGAGGAGAAGGACGACTACGACGAT
GGCAGCTACGGCCCCGTCCTCGTCCGTCTCGCCTGGCACGCCAGCGGCACCTATGACAAGGAGACCGGCACTGGTGGCTCCAACGGTGCCACCATGCGCTTCGCTCCCGAGTCTGACCAC
GGTGCCAACGCCGGCCTGAAGGCTGCTCGTGACTTCCTCGAGCCCGTCAAGG
CCAAGTTCCCTTGGATCACCTACTCCGACCTCTGGATCCTTGCCGGTGTCTGCGCCATCCAGGAGATG
CAGGGCCCCAAGATCCCCTACCGCCCCGGTCGCCAGGACCGTGATGTCGCTGCCTGCACTCCCGACGGCCGTCTTCCTGATGCCTCCCAGGCCCAGGACCATCTCCGCAACATCTTCTAC
CGCATGGGCTTCAACGATCAGGAGATCGTTGCTCTTGCCGGTGCTCACGCTCTCGGCCGCTGTCACACCGACCGCTCCGGCTTCGACGGCCCCTGGACCTTCTCCCCTACCGTCATGACC
AACGACTACTACAAGCTCCTTCTCGACGAGAAGTGGCAGTGGAAGAAGTGGAACGGCCCCAAGCAGTATGAGGACAAGAAGACCAAGTCCCTCATGATGCTTCCCGCCGACATGGCCCTC
ATCCAGGACAAGACTTTCAAGCAATGGGTTCAGAAGTACGCCGCCAACAACGAGCTCTTCTTCCAGGACTTCTCCAACGTCATTGTCAAGCTCTTCGAGCTCGGCGTTCCCTTCGCCGAG
AACTCCGAGCGCTGGGTCTTCAAGCCCGTCAACGCCTAA

Retrieve as FASTA