Entry information : AbraGPx01
Entry ID 8465
Creation 2011-08-11 (Marcia Pinheiro Margis)
Last sequence changes 2011-08-12 (Christophe Dunand)
Sequence status complete
Reviewer Passaia Gisèle
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: AbraGPx01
Name AbraGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Alternaria
Organism Alternaria brassicicola    [TaxId: 29001 ]
Cellular localisation N/D
Tissue type N/D
Inducer Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value AbraGPx01
start..stop
S start..stop
AalteGPx01 302 8e-106 1..156 72..237
SturGPx01 288 3e-101 1..153 1..163
ClunGPx01 287 6e-101 1..153 1..163
PtritGPx01 291 7e-101 1..153 104..266
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 700612..700654 43 N° 2 700318..700553 236 N° 3 699888..700184 297  
complement(join(699888..700184,700318..700553,700612..700654))


exon

Literature and cross-references AbraGPx01
DNA ref. JGI genome:   Contig0 (700654..699888)
Protein sequence: AbraGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   193
PWM (Da):   %s   21422.06  
PI (pH):   %s   9.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFFDFKPKDKKGSPYDLKKLNGKVVLVVNTASKCGFTPQFEGLEKLYKDIKGKHPNDFEIIGFPCNQFGGQDPGSNDEIQEFCQVNYVNGAQADPAFEWLKNEKPGLMGLKRVKWNFEKFLVGRDGKVKARWASTKKPEDLKADIEKGVGLQINVRRERHVCMVTENTGRVGIHDGVLIPLALYGI

Retrieve as FASTA  
Remarks Complete sequence from genomic. 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCAACAAGCTTCTTCGACTTCAAGCCCAAGGACAGTACGTTTACTAATCACACCACCTATGCTGATGCGCTTTAGCCGCTAACAGCCCGCAGAGAAGGGCTCCCCCTACGA
TCTCAAAAAGCTCAACGGCAAAGTCGTCCTCGTTGTCAACACCGCCTCGAAATGCGGCTTCACGCCCCAATTCGAAGGCCTGGAGAAGCTATACAAGGACATCAAGGGCAAACACCCCAA
CGACTTTGAGATTATCGGTTTCCCCTGCAATCAGTTCGGTGGCCAGGACCCAGGCTCCAACGATGAGATTCAGGAATTCTGTCAGGTCAACTACGGC
GTCAGCTTCCCAGTCCTCGGAAA
GATTGATGCAAGTACAATCCACTCTCTCGCACATCATTTTTTTCGAAACACATACAAACCACACTTCAAGCGACGACTGAATACTGGCTAACCCTCTCTTCTTCCAATAGGTCAACGGCG
CACAAGCAGACCCCGCATTCGAATGGCTCAAGAACGAGAAGCCCGGCCTCATGGGCCTCAAGCGCGTAAAGTGGAACTTTGAGAAGTTCCTGGTCGGCCGTGACGGAAAGGTCAAGGCCA
GGTGGGCAAGCACCAAGAAGCCTGAGGACCTCAAGGCGGATATCGAAAAAGGAGTTGGGCTCCAAATAAACGTTAGACGTGAGCGTCATGTCTGCATGGTGACGGAGAACACTGGTCGCG
TTGGGATACATGATGGAGTATTGATACCACTTGCATTGTATGGAATT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCAACAAGCTTCTTCGACTTCAAGCCCAAGGACAAGAAGGGCTCCCCCTACGATCTCAAAAAGCTCAACGGCAAAGTCGTCCTCGTTGTCAACACCGCCTCGAAATGCGGC
TTCACGCCCCAATTCGAAGGCCTGGAGAAGCTATACAAGGACATCAAGGGCAAACACCCCAACGACTTTGAGATTATCGGTTTCCCCTGCAATCAGTTCGGTGGCCAGGACCCAGGCTCC
AACGATGAGATTCAGGAATTCTGTCAGGTCAACTACGGC
GTCAACGGCGCACAAGCAGACCCCGCATTCGAATGGCTCAAGAACGAGAAGCCCGGCCTCATGGGCCTCAAGCGCGTAAAG
TGGAACTTTGAGAAGTTCCTGGTCGGCCGTGACGGAAAGGTCAAGGCCAGGTGGGCAAGCACCAAGAAGCCTGAGGACCTCAAGGCGGATATCGAAAAAGGAGTTGGGCTCCAAATAAAC
GTTAGACGTGAGCGTCATGTCTGCATGGTGACGGAGAACACTGGTCGCGTTGGGATACATGATGGAGTATTGATACCACTTGCATTGTATGGAATT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGAGGGGC AACAAGCACA GCCCCGCGTA TCGCGACGAA CTTCAGGCCA GTTTTGCGAC ACAACTTAAA GCTCCGAAGC TTCACCACCA CTTTTGCACC TACTTACTCA ATTCTTACAC  GGTCCTATAT ACCTAGTACC GGGAAGAAGG TAGACCACGT GACAAACGAA ACAACAGGAA GAAGAGCGCT TTACACAACC ATGGCTTCCG CAACAAGCTT CTTCGACTTC AAGCCCAAGG  ACAAGAAGGG CTCCCCCTAC GATCTCAAAA AGCTCAACGG CAAAGTCGTC CTCGTTGTCA ACACCGCCTC GAAATGCGGC TTCACGCCCC AATTCGAAGG CCTGGAGAAG CTATACAAGG  ACATCAAGGG CAAACACCCC AACGACTTTG AGATTATCGG TTTCCCCTGC AATCAGTTCG GTGGCCAGGA CCCAGGCTCC AACGATGAGA TTCAGGAATT CTGTCAGGTC AACTACGGCG  TCAACGGCGC ACAAGCAGAC CCCGCATTCG AATGGCTCAA GAACGAGAAG CCCGGCCTCA TGGGCCTCAA GCGCGTAAAG TGGAACTTTG AGAAGTTCCT GGTCGGCCGT GACGGAAAGG  TCAAGGCCAG GTGGGCAAGC ACCAAGAAGC CTGAGGACCT CAAGGCGGAT ATCGAAAAAG GAGTTGGGCT CCAAATAAAC GTTAGACGTG AGCGTCATGT CTGCATGGTG ACGGAGAACA  CTGGTCGCGT TGGGATACAT GATGGAGTAT TGATACCACT TGCATTGTAT GGAATTTGAT GGCATTATTC ATGAATTCGC TGTGCATGGT TTGATGATTG TGACATGCAA ATCAAATCAT  GAGAACCCAA AAAAACGAAG CTATAAGAAT ATGATGGACT AGCTGTCTCT TCGAACAGAC AAGGCTTGCA TGTCCTATAG AGGACCAAGG ATGGTTCTAT GAGCCACTTC CTTTTCCAAA 
AAAAAACCAC CCCCCCCCA 

Retrieve as FASTA