Entry information : GmPrx311 (Glyma19g39270.1)
Entry ID 8469
Creation 2011-08-17 (Bruno Savelli)
Last sequence changes 2011-12-14 (Bruno Savelli)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx311 (Glyma19g39270.1)
Name (synonym) GmPrx311 (Glyma19g39270.1)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx311
start..stop
S start..stop
GmPrx138 500 2e-180 1..272 1..290
GmPrx137 469 4e-168 1..264 1..264
MtPrx04 429 2e-152 1..272 1..287
GmPrx37 410 8e-145 3..264 1..264
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46011005..46011214 210 N° 2 46010664..46010856 193 N° 3 46010382..46010552 171 N° 4 46009807..46010022 216
N° 5 46009579..46009758 180  
complement(join(46009579..46009758,46009807..46010022,46010382..46010552,4601066 4..46010856,46011005..46011214))


exon

Literature and cross-references GmPrx311 (Glyma19g39270.1)
DNA ref. Phytozome 12:   Gm19 (46011214..46009579)
Protein sequence: GmPrx311 (Glyma19g39270.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (302)
PWM (Da):   %s   35952.3 (33418.1) Transmb domain:   %s   o284-306i (i263-285o)
PI (pH):   %s   8.49 (8.55) Peptide Signal:   %s   cut: 23 range:23-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMRFFLVACLAMFCILEVCQGGNLRKQFYKKTCPQAEQMVRTKIQEHVSGRSDLPAKLIRMHFHDCFVRGCDGSVLLDSTATNTAEKDAIPNLSLAGFDVIDEIKEALEAKxCLGAVSCADILTLAARDAVAVKPMWEVLTGRRDGRVSISGETLANLPAPFFNFTQLKQSFASKGLTVHDLVVLSGTFNIGIGHCNLFSNRLFNFTGKGDQDPSLNPTYANFLKTKCQGLSDTTTTIEMDPNSSNTFDRDYYSILRQNKGLFNELVKQNKEKVLCCQLLIKSCFLVLIWCVSFATFFCHNLMLVAKPLKFVLRYLQMGVKNK

Retrieve as FASTA  
Remarks Comolete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAGATGAGATTTTTCCTTGTAGCTTGTTTGGCAATGTTCTGCATCCTAGAGGTTTGCCAAGGAGGCAACCTCAGAAAGCAATTCTACAAGAAAACCTGTCCTCAAGCCGAGCAGATGGT
TAGAACAAAAATCCAGGAACATGTCTCTGGAAGGTCTGATTTGCCTGCCAAGTTGATTAGAATGCATTTTCATGACTGTTTTGTCAGGGT
AAACATTCCTAATCCTTGCTCTTTATGAAT
ACTAATTACACCATGCATCATTTCAAATTTAAATACAACAATGCTAATTTCCATGCAATGTGTTTTAGAGCTACATATAAATGATTCACGTGGCATTGTTGTAAACAACATTTCAGGGTT
GTGATGGTTCGGTTTTGCTGGACTCCACTGCCACCAACACTGCAGAGAAGGATGCCATTCCCAATTTATCTTTGGCTGGCTTTGATGTCATAGATGAAATAAAAGAAGCATTGGAGGCAA
AAANNTGTCTCGGAGCTGTATCTTGTGCTGATATATTAACATTGGCAGCTAGGGACGCTGTTGCCGTCAAA
GTAAGCTAAAGCCTAAAGCTAACCATTATATATACTACAAAATTTGGGT
ATGTTTTCATGTAATCTTAGTTTATGCACGTAGCTGATTGATAATATTTGCAGTTTAATAAGCCAATGTGGGAAGTGCTTACCGGTAGAAGAGATGGCAGAGTATCCATAAGTGGTGAAA
CCTTAGCCAATCTGCCAGCACCTTTCTTCAATTTCACCCAGCTCAAACAAAGCTTTGCTAGTAAAGGGCTTACTGTGCATGACTTGGTTGTGTTATCAGGTACATTTAATATT
TTATAAA
CTCAATGCTAAACATAAATAATTAATATTATAATAAGTACTAAGGACAAAATTTAGATGCAGTTTCTTATATACTTTAAGAACTATTTTAACATTAGAATTGGAATTTTATTTTAGTAAT
TCATACAATGAAAGTTTACATTAAATGTGTTAACTTGGGTTATTGAGATGAAACTTCAATTTTTAATTGCGCAATGTTGCTTAAAACATTTAGGGAACTACATCTATTTTTTTTTTTTCA
AATACTAATTGTAATCAAGGGATCACCCAAATTATCACAATCAGATATTAAATTAAACTGACTAAATTAACCTATTGGCTGTTTGTGTGTGTGTGTAGGAGCACACGCAATTGGGATAGG
TCATTGTAACTTATTCAGTAACAGGCTTTTCAACTTCACTGGAAAAGGTGATCAAGATCCTTCTTTGAATCCTACTTATGCCAACTTTTTGAAGACAAAATGCCAAGGTCTCAGTGACAC
CACCACAACAATAGAGATGGATCCTAACAGCTCAAACACCTTTGACCGTGACTATTATTCTATCCTTCGCCAGAACAAGGGTCTATTC
CAATCAGATGCTGCCCTTTTAACAACTAAGAT
ATCAAGAAACATTGTCAACGAATTGGTTAAACAAAACAAGGAGAAAGTGCTCTGTTGTCAACTCTTAATTAAGAGCTGTTTTCTGGTTTTAATTTGGTGTGTTTCTTTTGCTACATTTTT
TTGTCACAATTTAATGTTGGTTGCAAAGCCGCTAAAGTTTGTTTTGAGATACCTTCAAATGGGAGTGAAAAATAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAGATGAGATTTTTCCTTGTAGCTTGTTTGGCAATGTTCTGCATCCTAGAGGTTTGCCAAGGAGGCAACCTCAGAAAGCAATTCTACAAGAAAACCTGTCCTCAAGCCGAGCAGATGGT
TAGAACAAAAATCCAGGAACATGTCTCTGGAAGGTCTGATTTGCCTGCCAAGTTGATTAGAATGCATTTTCATGACTGTTTTGTCAGGGT
TTGTGATGGTTCGGTTTTGCTGGACTCCAC
TGCCACCAACACTGCAGAGAAGGATGCCATTCCCAATTTATCTTTGGCTGGCTTTGATGTCATAGATGAAATAAAAGAAGCATTGGAGGCAAAAANNTGTCTCGGAGCTGTATCTTGTGC
TGATATATTAACATTGGCAGCTAGGGACGCTGTTGCCGTCAAA
CCAATGTGGGAAGTGCTTACCGGTAGAAGAGATGGCAGAGTATCCATAAGTGGTGAAACCTTAGCCAATCTGCCAGC
ACCTTTCTTCAATTTCACCCAGCTCAAACAAAGCTTTGCTAGTAAAGGGCTTACTGTGCATGACTTGGTTGTGTTATCAGGTACATTTAATATT
GGGATAGGTCATTGTAACTTATTCAG
TAACAGGCTTTTCAACTTCACTGGAAAAGGTGATCAAGATCCTTCTTTGAATCCTACTTATGCCAACTTTTTGAAGACAAAATGCCAAGGTCTCAGTGACACCACCACAACAATAGAGAT
GGATCCTAACAGCTCAAACACCTTTGACCGTGACTATTATTCTATCCTTCGCCAGAACAAGGGTCTATTC
AACGAATTGGTTAAACAAAACAAGGAGAAAGTGCTCTGTTGTCAACTCTT
AATTAAGAGCTGTTTTCTGGTTTTAATTTGGTGTGTTTCTTTTGCTACATTTTTTTGTCACAATTTAATGTTGGTTGCAAAGCCGCTAAAGTTTGTTTTGAGATACCTTCAAATGGGAGT
GAAAAATAAA

Retrieve as FASTA