Entry information : CgraCIIAA03
Entry ID 8473
Creation 2011-08-24 (Christophe Dunand)
Last sequence changes 2011-08-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-08-25 (Christophe Dunand)
Peroxidase information: CgraCIIAA03
Name CgraCIIAA03
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum graminicola (Glomerella graminicola)    [TaxId: 31870 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgraCIIAA03
start..stop
S start..stop
ChigCIIAA03 729 0 1..406 1..406
CfioCIIAA03_MH18 683 0 1..403 1..403
CfioCIIAA03_PJ7 681 0 1..403 1..403
CgloCIIAA01_Naragc5 561 0 1..402 1..401
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35425..36423 999 N° 2 35134..35355 222  
complement(join(35134..35355,35425..36423))


exon

Literature and cross-references CgraCIIAA03
DNA ref. GenBank:   GG697406.1 (36423..35134)
Protein sequence: CgraCIIAA03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   406 (389)
PWM (Da):   %s   43600.86 (42000.0)  
PI (pH):   %s   4.77 (4.71) Peptide Signal:   %s   cut: 18 range:18-406
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTASLIGALVAGVAFAHPGMNIKKLIADAELQTRQFGGGGPSTELIGDLVDLRERDLTQTGSAIRDILIAEAPGADVETFYDESELAPRDSEDCASDECCIWKYIADDMAKQMVGNAGRCNSVARGAIRLGFHDAASWSKSTGGTGADGSIILANECKTRSDNKGLEDICDIMSGWYAKYKKYGISMADLIQTGANVGTVSCPLGPRVRTFIGRKDTTTPAVQNLLPDPKDSSEKLFKIFADKSFTPAGLVALLGAHSTSQQRFVDPARAESPQDSTPGTWDIAFYQQTLNPNAPPAVFKFQSDINVSLDPQTNDLWRLFSAGPRGQVAWGKAYAVEYVRMSLLGVNNINDLTECTKVLPPFRPDFQQPDQELLDKVMGGILSSDLVKQALEKGDKIPPAALSNP*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST available.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTGCCTCCCTCATCGGCGCCCTCGTGGCAGGCGTTGCGTTTGCTCATCCTGGCATGAACATAAAGAAGCTGATAGCTGATGCTGAGCTCCAAACTCGACAATTCGGCGGCGGT
GGCCCCTCGACGGAGCTGATCGGCGACCTCGTTGATCTACGAGAACGCGATCTCACCCAGACCGGATCAGCGATTAGGGATATCTTGATCGCCGAGGCCCCTGGCGCGGACGTGGAGACC
TTTTACGACGAGTCTGAGCTCGCCCCCAGGGACTCTGAGGATTGTGCCAGCGATGAATGCTGCATCTGGAAGTACATTGCCGACGACATGGCCAAGCAAATGGTGGGAAACGCCGGTCGA
TGCAACAGCGTCGCTCGCGGCGCCATCCGTCTCGGCTTCCATGACGCCGCATCCTGGTCCAAGTCGACGGGAGGCACCGGCGCCGATGGCTCCATCATTCTTGCCAACGAGTGTAAGACA
CGGTCTGACAACAAGGGTCTCGAGGACATATGCGACATCATGTCGGGCTGGTATGCCAAGTACAAGAAATATGGCATCAGCATGGCCGACTTGATCCAGACAGGCGCCAATGTTGGCACC
GTTTCTTGCCCCCTCGGCCCCCGCGTTCGCACTTTCATCGGCCGCAAGGACACGACCACACCCGCAGTCCAGAACCTCCTCCCTGACCCTAAGGACAGCTCGGAAAAGCTCTTCAAGATC
TTCGCCGATAAGTCGTTCACGCCCGCCGGTCTCGTGGCCCTCCTGGGCGCCCACAGCACCAGCCAGCAGCGCTTTGTTGATCCCGCACGCGCCGAGTCGCCCCAGGACAGCACGCCGGGA
ACTTGGGACATCGCCTTCTACCAGCAGACGCTCAACCCGAACGCGCCGCCCGCTGTCTTTAAGTTTCAGAGCGACATCAACGTGTCTTTGGACCCGCAGACCAACGATTTGTGGAGGCTC
TTCTCGGCGGGACCGCGCGGCCAGGTCGCGTGGGGCAAG
GTAAGCTTTTCCCCGTGACACGTTCGTCCCATCTTATAACCTTATATTGACTAACACTGTAACACTTAGGCCTACGCTGTC
GAGTACGTCCGCATGTCCCTTCTTGGCGTCAACAACATCAACGATTTGACCGAGTGCACAAAAGTCCTGCCACCTTTCCGTCCCGACTTCCAACAGCCTGATCAGGAGCTCCTCGACAAG
GTCATGGGGGGCATTCTCAGCTCCGACCTCGTCAAGCAGGCCCTCGAGAAGGGCGACAAGATCCCCCCTGCCGCGTTGTCGAATCCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTGCCTCCCTCATCGGCGCCCTCGTGGCAGGCGTTGCGTTTGCTCATCCTGGCATGAACATAAAGAAGCTGATAGCTGATGCTGAGCTCCAAACTCGACAATTCGGCGGCGGT
GGCCCCTCGACGGAGCTGATCGGCGACCTCGTTGATCTACGAGAACGCGATCTCACCCAGACCGGATCAGCGATTAGGGATATCTTGATCGCCGAGGCCCCTGGCGCGGACGTGGAGACC
TTTTACGACGAGTCTGAGCTCGCCCCCAGGGACTCTGAGGATTGTGCCAGCGATGAATGCTGCATCTGGAAGTACATTGCCGACGACATGGCCAAGCAAATGGTGGGAAACGCCGGTCGA
TGCAACAGCGTCGCTCGCGGCGCCATCCGTCTCGGCTTCCATGACGCCGCATCCTGGTCCAAGTCGACGGGAGGCACCGGCGCCGATGGCTCCATCATTCTTGCCAACGAGTGTAAGACA
CGGTCTGACAACAAGGGTCTCGAGGACATATGCGACATCATGTCGGGCTGGTATGCCAAGTACAAGAAATATGGCATCAGCATGGCCGACTTGATCCAGACAGGCGCCAATGTTGGCACC
GTTTCTTGCCCCCTCGGCCCCCGCGTTCGCACTTTCATCGGCCGCAAGGACACGACCACACCCGCAGTCCAGAACCTCCTCCCTGACCCTAAGGACAGCTCGGAAAAGCTCTTCAAGATC
TTCGCCGATAAGTCGTTCACGCCCGCCGGTCTCGTGGCCCTCCTGGGCGCCCACAGCACCAGCCAGCAGCGCTTTGTTGATCCCGCACGCGCCGAGTCGCCCCAGGACAGCACGCCGGGA
ACTTGGGACATCGCCTTCTACCAGCAGACGCTCAACCCGAACGCGCCGCCCGCTGTCTTTAAGTTTCAGAGCGACATCAACGTGTCTTTGGACCCGCAGACCAACGATTTGTGGAGGCTC
TTCTCGGCGGGACCGCGCGGCCAGGTCGCGTGGGGCAAG
GCCTACGCTGTCGAGTACGTCCGCATGTCCCTTCTTGGCGTCAACAACATCAACGATTTGACCGAGTGCACAAAAGTCCTG
CCACCTTTCCGTCCCGACTTCCAACAGCCTGATCAGGAGCTCCTCGACAAGGTCATGGGGGGCATTCTCAGCTCCGACCTCGTCAAGCAGGCCCTCGAGAAGGGCGACAAGATCCCCCCT
GCCGCGTTGTCGAATCCCTAG

Retrieve as FASTA