Entry information : CgraCIIAB07
Entry ID 8477
Creation 2011-08-24 (Christophe Dunand)
Last sequence changes 2011-08-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-09-28 (Christophe Dunand)
Peroxidase information: CgraCIIAB07
Name CgraCIIAB07
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum graminicola (Glomerella graminicola)    [TaxId: 31870 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgraCIIAB07
start..stop
S start..stop
ChigCIIAB07 417 1e-149 1..263 1..262
CgloCIIAB01_Naragc5 392 5e-140 1..263 1..261
CgloCIIAB01_ST23 392 1e-139 8..263 8..261
MgrCIIAB03 275 1e-93 26..262 28..264
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 379355..379688 334 N° 2 378900..379287 388 N° 3 378775..378844 70  
complement(join(378775..378844,378900..379287,379355..379688))


exon

Literature and cross-references CgraCIIAB07
DNA ref. GenBank:   GG697349.1 (379688..378775)
Protein sequence: CgraCIIAB07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   263 (238)
PWM (Da):   %s   27857.55 (25161.3)  
PI (pH):   %s   5.34 (4.78) Peptide Signal:   %s   cut: 26 range:26-263
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQFSRRCTSFLAASLSVTTICNAHARSCPPVWTEIAADLKGSFAGCPSEARQAIRAAFHDCFPGSCDGSLILANECFDREENMQMQPICDILGEKAAAYNVSTADMIQAAAAFGVAACGGPKIYFLVGRKDSSVPSTEGVLPTQDSDAATQITAFKKKGFSATDLVALVGAHSAGRSLQELSFDSTPEELDSTVFYPETLEETTPTSLGSDVALGNDKATKHIWKRFGASQTQWNSAFKLAMGKMSIMGNNLGKLTDCSKLVA

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST available.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAATTCTCTCGGAGATGCACTTCTTTCCTGGCAGCCTCTCTATCAGTCACCACGATCTGCAATGCACATGCACGATCCTGCCCCCCGGTCTGGACCGAGATTGCAGCTGACCTGAAA
GGTTCCTTTGCAGGCTGTCCCAGTGAGGCGAGACAGGCAATTCGTGCCGCATTCCATGACTGTTTCCCTGGATCATGCGACGGGTCGTTGATACTAGCCAACGAGTGCTTTGATAGAGAG
GAAAACATGCAGATGCAACCGATTTGCGACATATTGGGTGAAAAAGCCGCTGCATACAATGTCAGCACCGCCGACATGATACAAGCGGCAGCAG
GTAAGTAGAGGGACTACAGCCATCTA
CAACGAGAGATTTGCGCAAGTTTCATTGACGGAGAAGCTAGCTTTCGGCGTTGCAGCCTGTGGTGGTCCCAAAATCTACTTCCTCGTTGGGCGAAAGGATTCATCCGTACCCAGCACCGA
GGGCGTGCTGCCCACACAAGATTCAGACGCAGCTACCCAGATCACCGCCTTCAAGAAGAAAGGATTCTCTGCTACGGATCTTGTGGCCCTTGTCGGGGCCCATAGTGCGGGACGGAGCTT
ACAGGAGCTGTCTTTCGACTCGACCCCGGAGGAGCTGGATAGCACCGTTTTCTACCCGGAAACGCTAGAGGAGACGACACCGACCTCCTTGGGCAGCGATGTTGCGCTCGGTAATGATAA
AGCGACTAAGCATATCTGGAAAAGATTTGGGGCCAGCCAGACACAGTGGAACTCTGCATTCAAGCTAGC
GTAAGTGCTATATTACTTTTACTACGTCGGACGGCCCAACTAATCCATCGG
TCAGAATGGGGAAGATGAGTATCATGGGAAATAACTTGGGGAAGCTGACCGATTGCTCAAAGTTGGTGGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAATTCTCTCGGAGATGCACTTCTTTCCTGGCAGCCTCTCTATCAGTCACCACGATCTGCAATGCACATGCACGATCCTGCCCCCCGGTCTGGACCGAGATTGCAGCTGACCTGAAA
GGTTCCTTTGCAGGCTGTCCCAGTGAGGCGAGACAGGCAATTCGTGCCGCATTCCATGACTGTTTCCCTGGATCATGCGACGGGTCGTTGATACTAGCCAACGAGTGCTTTGATAGAGAG
GAAAACATGCAGATGCAACCGATTTGCGACATATTGGGTGAAAAAGCCGCTGCATACAATGTCAGCACCGCCGACATGATACAAGCGGCAGCAG
CTTTCGGCGTTGCAGCCTGTGGTGGT
CCCAAAATCTACTTCCTCGTTGGGCGAAAGGATTCATCCGTACCCAGCACCGAGGGCGTGCTGCCCACACAAGATTCAGACGCAGCTACCCAGATCACCGCCTTCAAGAAGAAAGGATTC
TCTGCTACGGATCTTGTGGCCCTTGTCGGGGCCCATAGTGCGGGACGGAGCTTACAGGAGCTGTCTTTCGACTCGACCCCGGAGGAGCTGGATAGCACCGTTTTCTACCCGGAAACGCTA
GAGGAGACGACACCGACCTCCTTGGGCAGCGATGTTGCGCTCGGTAATGATAAAGCGACTAAGCATATCTGGAAAAGATTTGGGGCCAGCCAGACACAGTGGAACTCTGCATTCAAGCTA
GC
AATGGGGAAGATGAGTATCATGGGAAATAACTTGGGGAAGCTGACCGATTGCTCAAAGTTGGTGGCCTGA

Retrieve as FASTA