Entry information : CgraCcP01
Entry ID 8478
Creation 2011-08-24 (Christophe Dunand)
Last sequence changes 2011-08-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-08-24 (Christophe Dunand)
Peroxidase information: CgraCcP01
Name CgraCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum graminicola (Glomerella graminicola)    [TaxId: 31870 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgraCcP01
start..stop
S start..stop
ChigCcP 709 0 1..361 1..361
CgloCcP01_ST23 692 0 1..359 1..359
CgloCcP01_Naragc5 680 0 1..359 1..359
CfioCcP01_MH18 677 0 1..361 1..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 638576..639068 493 N° 2 639170..639543 374 N° 3 639603..639821 219  
join(638576..639068,639170..639543,639603..639821)


exon

Literature and cross-references CgraCcP01
DNA ref. GenBank:   GG697344.1 (638576..639821)
Protein sequence: CgraCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361
PWM (Da):   %s   40223.06  
PI (pH):   %s   9.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASTRQFARAALRTSTRTSFAVAPRQAFRQQGRRFYSSEPAKSGSSTWLWLSGLAVAGAGGVYLYTKEGGVSAGSTAKVVNPTKADYEKVYKVIADRLEENDQYDDGSYGPVLVRLAWHASGTYDKETNTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKQQFPWISYSDLWILGGVAAIQEMQGPIIPFRPGRKDGEAAACTPDGRLPDASKREKHLRDIFYRMGFNDQEIVALAGAHALGRCHTDRSGFDGPWTFSPTVMTNDYYKLLLNEKWQWKKWDGPAYEDKSTKSLMMLPADYALIQDKTFKKYVEQYAKDNEAFFKDFSNVIVKLFELGVPFAQGAEERWTFKPTWQN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST available.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTTCCACGAGACAGTTCGCCCGCGCGGCGCTGAGAACCTCTACCAGAACCTCCTTCGCCGTCGCTCCCCGCCAGGCCTTCCGCCAGCAGGGCCGCCGCTTCTACTCCTCCGAG
CCCGCCAAGTCTGGCAGCTCCACCTGGCTTTGGCTCTCCGGTCTGGCCGTCGCCGGTGCCGGTGGCGTCTACCTCTACACCAAGGAGGGCGGCGTCTCTGCCGGCTCGACCGCCAAGGTC
GTTAACCCCACCAAGGCCGACTACGAGAAGGTTTACAAGGTCATCGCCGACCGCCTCGAGGAAAACGACCAGTACGATGACGGCAGCTACGGCCCCGTCCTCGTCCGCCTCGCCTGGCAC
GCCAGCGGTACCTACGACAAGGAGACCAACACTGGCGGCAGCAACGGTGCCACCATGCGTTTCGCCCCCGAGTCCGACCACGGTGCCAACGCTGGCCTGAAGGCTGCCCGCGACTTCCTT
GAGCCTGTCAAGC
GTGAGTAGAAACCCCCAAGCCCCCATGCGATCGAGTCTGGAAAAGCATCCTTGCCGTCTCGTTGCCACCGTCGGACACAACTTGCTGACTGTCTCTCGCAGAGCAAT
TCCCTTGGATCTCTTACTCTGACCTTTGGATCCTCGGCGGTGTTGCCGCCATCCAGGAGATGCAGGGCCCCATCATCCCCTTCCGCCCCGGCCGCAAGGACGGTGAGGCCGCCGCCTGCA
CCCCCGATGGCCGTCTCCCCGACGCCTCCAAGCGCGAGAAGCACCTCCGCGACATCTTCTACCGCATGGGTTTCAACGACCAAGAGATTGTTGCCCTGGCCGGCGCTCACGCTCTCGGCC
GTTGCCACACCGACCGCTCCGGCTTCGACGGCCCCTGGACTTTCTCTCCCACCGTCATGACCAACGACTACTACAAGCTGCTCCTCAACGAGAAGTGGCAGTGGAAGAAGTGGGACGGTC
CCGCTCAG
GTAAGATTTGTAGCCACCCGGCAGACGTGAGTGAATTGATCGCTGACGGTATTGTGCAGTACGAGGACAAGAGCACCAAGTCCCTAATGATGCTTCCCGCCGACTACGCCCT
GATCCAGGACAAGACATTCAAGAAGTACGTCGAGCAGTACGCCAAGGACAACGAGGCCTTCTTCAAGGACTTCTCCAACGTCATCGTCAAGCTGTTTGAGCTTGGCGTTCCCTTTGCCCA
GGGCGCTGAGGAGCGCTGGACCTTCAAGCCCACTTGGCAGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTTCCACGAGACAGTTCGCCCGCGCGGCGCTGAGAACCTCTACCAGAACCTCCTTCGCCGTCGCTCCCCGCCAGGCCTTCCGCCAGCAGGGCCGCCGCTTCTACTCCTCCGAG
CCCGCCAAGTCTGGCAGCTCCACCTGGCTTTGGCTCTCCGGTCTGGCCGTCGCCGGTGCCGGTGGCGTCTACCTCTACACCAAGGAGGGCGGCGTCTCTGCCGGCTCGACCGCCAAGGTC
GTTAACCCCACCAAGGCCGACTACGAGAAGGTTTACAAGGTCATCGCCGACCGCCTCGAGGAAAACGACCAGTACGATGACGGCAGCTACGGCCCCGTCCTCGTCCGCCTCGCCTGGCAC
GCCAGCGGTACCTACGACAAGGAGACCAACACTGGCGGCAGCAACGGTGCCACCATGCGTTTCGCCCCCGAGTCCGACCACGGTGCCAACGCTGGCCTGAAGGCTGCCCGCGACTTCCTT
GAGCCTGTCAAGC
AGCAATTCCCTTGGATCTCTTACTCTGACCTTTGGATCCTCGGCGGTGTTGCCGCCATCCAGGAGATGCAGGGCCCCATCATCCCCTTCCGCCCCGGCCGCAAGGAC
GGTGAGGCCGCCGCCTGCACCCCCGATGGCCGTCTCCCCGACGCCTCCAAGCGCGAGAAGCACCTCCGCGACATCTTCTACCGCATGGGTTTCAACGACCAAGAGATTGTTGCCCTGGCC
GGCGCTCACGCTCTCGGCCGTTGCCACACCGACCGCTCCGGCTTCGACGGCCCCTGGACTTTCTCTCCCACCGTCATGACCAACGACTACTACAAGCTGCTCCTCAACGAGAAGTGGCAG
TGGAAGAAGTGGGACGGTCCCGCTCAG
TACGAGGACAAGAGCACCAAGTCCCTAATGATGCTTCCCGCCGACTACGCCCTGATCCAGGACAAGACATTCAAGAAGTACGTCGAGCAGTAC
GCCAAGGACAACGAGGCCTTCTTCAAGGACTTCTCCAACGTCATCGTCAAGCTGTTTGAGCTTGGCGTTCCCTTTGCCCAGGGCGCTGAGGAGCGCTGGACCTTCAAGCCCACTTGGCAG
AATTAA

Retrieve as FASTA