Entry information : SbPrx36 (Sobic.002G391200.1 [2.1] / SB02G040670 [1.4])
Entry ID 848
Creation 2005-12-19 (Christophe Dunand)
Last sequence changes 2005-12-19 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx36 (Sobic.002G391200.1 [2.1] / SB02G040670 [1.4])
Name (synonym) SbPrx36 (Sobic.002G391200.1 [2.1] / SB02G040670 [1.4])
Class Class III peroxidase    [Orthogroup: Prx095]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Roots
Seedlings
Inducers Acid treatment
Alkaline treatment
Heat shock stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx36
start..stop
S start..stop
SbPrx37 610 0 1..368 1..364
ZmPrx30 596 0 1..369 1..391
ZmPrx78 592 0 1..369 1..391
ZmPrx97 586 0 2..368 1..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 74576375..74576704 330 N° 2 74575452..74576231 780  
complement(join(74575452..74576231,74576375..74576704))


exon

Literature and cross-references SbPrx36 (Sobic.002G391200.1 [2.1] / SB02G040670 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_2 (74576704..74575452)
Protein sequence: SbPrx36 (Sobic.002G391200.1 [2.1] / SB02G040670 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   369 (348)
PWM (Da):   %s   38967.21 (36837.1)  
PI (pH):   %s   5.33 (5.10) Peptide Signal:   %s   cut: 22 range:22-369
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSPNKLAVLTVFALLGSVSCQDGGYYPPPPAPATPPPPACPPPPPSPSPPPATPAPPPPPGTQLMVGYYKNKCGAYVDVEAIVKKHVNATDAGMQAGLVRMFFHDCFIRGCDASVLLDSFSNDTSLTPEKFSVPNFPSLRGYEVIDAAKAEIEAACPSVVSCADIVAFAARDASYFLSGGGINFAMPAGRYDGNVSLASEALPNLPPPFAGFDLLVQMFAAKGLDYVDMITLSGAHSIGRSHCSSFSRDRLPPSNTSDMDPAFAATLQAACASPNGTDNTVVQDFQTPDVLDNQYYKDVLAHKVLFTSDAALTTNITSNNLVRAYADFVPFLWQNKFGKAMVKMGGIEIKTAANGEIRTNCRKVNGRP*

Retrieve as FASTA  
Remarks Complete sequence from 8 ESTs and genomic (chromo 2, intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAGCCCTAATAAGCTCGCCGTCCTCACTGTCTTCGCCCTGCTCGGCTCCGTGTCTTGCCAGGACGGAGGCTACTACCCTCCTCCTCCGGCTCCGGCCACCCCGCCACCACCAGCA
TGCCCTCCACCTCCTCCAAGCCCAAGCCCACCCCCAGCTACGCCGGCACCCCCACCACCCCCAGGGACGCAACTCATGGTCGGATACTACAAGAACAAGTGCGGCGCTTACGTGGACGTT
GAGGCCATCGTCAAGAAGCACGTCAATGCCACTGATGCTGGCATGCAGGCCGGGCTTGTCCGTATGTTCTTCCACGACTGCTTCATCCGT
GTAAGTTCTCCTCCATTGATCAACAGCTAG
CCATGCCCTACATATTATGCATGCGATGCCACAATAATAATGAGCAAGACATTGTGATATATATATGGACATGCGATGTGATGTGATGTGATGCATTGTTTCATCATCATCAGGGATGCG
ACGCCTCCGTCCTCCTGGACTCGTTCAGCAACGACACGAGCCTGACCCCGGAGAAGTTCAGCGTGCCCAACTTCCCCAGCCTACGCGGGTACGAGGTGATCGACGCGGCCAAGGCGGAGA
TCGAGGCGGCATGCCCCAGCGTCGTCTCGTGCGCGGACATCGTCGCGTTCGCCGCCCGCGACGCGTCCTACTTCCTCAGCGGCGGCGGCATCAACTTCGCCATGCCCGCCGGCCGCTACG
ACGGCAACGTGTCCCTCGCCAGCGAGGCCCTGCCGAACCTTCCCCCGCCGTTCGCCGGCTTCGACCTGCTCGTCCAGATGTTCGCCGCCAAGGGGCTGGACTACGTCGACATGATCACGC
TCTCCGGCGCGCACAGCATCGGCCGCTCCCACTGCTCCTCCTTCAGCAGGGACCGCCTGCCGCCCAGCAACACCTCCGACATGGACCCGGCGTTCGCCGCCACGCTGCAGGCTGCCTGCG
CGTCGCCCAACGGCACCGACAACACGGTGGTGCAGGACTTCCAGACCCCCGACGTCCTGGACAACCAGTACTACAAGGACGTGCTGGCACACAAGGTGCTCTTCACGTCGGACGCCGCGC
TCACCACCAACATCACATCCAACAACCTGGTGCGCGCCTACGCGGACTTCGTTCCCTTCCTGTGGCAGAATAAGTTCGGCAAGGCCATGGTGAAGATGGGCGGCATAGAGATCAAGACCG
CCGCCAACGGGGAGATCAGGACCAACTGCCGCAAAGTCAACGGCAGGCCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAGCCCTAATAAGCTCGCCGTCCTCACTGTCTTCGCCCTGCTCGGCTCCGTGTCTTGCCAGGACGGAGGCTACTACCCTCCTCCTCCGGCTCCGGCCACCCCGCCACCACCAGCA
TGCCCTCCACCTCCTCCAAGCCCAAGCCCACCCCCAGCTACGCCGGCACCCCCACCACCCCCAGGGACGCAACTCATGGTCGGATACTACAAGAACAAGTGCGGCGCTTACGTGGACGTT
GAGGCCATCGTCAAGAAGCACGTCAATGCCACTGATGCTGGCATGCAGGCCGGGCTTGTCCGTATGTTCTTCCACGACTGCTTCATCCGT
GGATGCGACGCCTCCGTCCTCCTGGACTCG
TTCAGCAACGACACGAGCCTGACCCCGGAGAAGTTCAGCGTGCCCAACTTCCCCAGCCTACGCGGGTACGAGGTGATCGACGCGGCCAAGGCGGAGATCGAGGCGGCATGCCCCAGCGTC
GTCTCGTGCGCGGACATCGTCGCGTTCGCCGCCCGCGACGCGTCCTACTTCCTCAGCGGCGGCGGCATCAACTTCGCCATGCCCGCCGGCCGCTACGACGGCAACGTGTCCCTCGCCAGC
GAGGCCCTGCCGAACCTTCCCCCGCCGTTCGCCGGCTTCGACCTGCTCGTCCAGATGTTCGCCGCCAAGGGGCTGGACTACGTCGACATGATCACGCTCTCCGGCGCGCACAGCATCGGC
CGCTCCCACTGCTCCTCCTTCAGCAGGGACCGCCTGCCGCCCAGCAACACCTCCGACATGGACCCGGCGTTCGCCGCCACGCTGCAGGCTGCCTGCGCGTCGCCCAACGGCACCGACAAC
ACGGTGGTGCAGGACTTCCAGACCCCCGACGTCCTGGACAACCAGTACTACAAGGACGTGCTGGCACACAAGGTGCTCTTCACGTCGGACGCCGCGCTCACCACCAACATCACATCCAAC
AACCTGGTGCGCGCCTACGCGGACTTCGTTCCCTTCCTGTGGCAGAATAAGTTCGGCAAGGCCATGGTGAAGATGGGCGGCATAGAGATCAAGACCGCCGCCAACGGGGAGATCAGGACC
AACTGCCGCAAAGTCAACGGCAGGCCGTGA

Retrieve as FASTA