Entry information : GgrCIIAC01
Entry ID 8482
Creation 2011-08-24 (Christophe Dunand)
Last sequence changes 2011-08-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-08-24 (Christophe Dunand)
Peroxidase information: GgrCIIAC01
Name GgrCIIAC01
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Magnaporthaceae Gaeumannomyces
Organism Gaeumannomyces graminis    [TaxId: 29850 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GgrCIIAC01
start..stop
S start..stop
MpoaCIIAC01 408 5e-146 96..309 1..214
CfioCIIAC_PJ7 357 2e-124 22..308 21..307
CfioCIIAC01_MH18 356 4e-124 36..308 35..307
CgloCIIAC01_Naragc5 352 2e-122 49..309 48..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10461..10893 433 N° 2 10118..10361 244 N° 3 9857..10039 183 N° 4 9725..9794 70
complement(join(9725..9794,9857..10039,10118..10361,10461..10893))


exon

Literature and cross-references GgrCIIAC01
DNA ref. GenBank:   ADBI01000411.1 (10893..9725)
Protein sequence: GgrCIIAC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   309 (291)
PWM (Da):   %s   32277.97 (30457.9)  
PI (pH):   %s   7.78 (7.30) Peptide Signal:   %s   cut: 19 range:19-309
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLSITLVLPSLLALAGAVPGPKGGDDSGKSGTRGDDGGRGGGSGKCPEVWGAVKAELNQKFMTGTECNGLARAAIRAIFHDCGSWDQSQGLVGGCDGSLITGVTPDVELDRPENRGLQTVAAYLKDAAARHGTSVADMIVFAGNAATVLCPGGPRVKTFIGRKDSTNSAKPGGLPDVFDTAANLVDLFAKKGYSQAELAALMGAHSTSTQRFVDPSQAGKAQDSTPGQWDVKYYKETIDYAKTGKTPNNVFVFPSDAKLATYQDVGKKFEGFVNNQNKWSSAFGNAMEKMALFGNDKNNMVDCTNALG

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTCAGCATCACCCTCGTCCTCCCCAGCCTCTTGGCGCTGGCCGGCGCCGTCCCGGGCCCCAAGGGCGGCGACGACAGCGGCAAGTCTGGCACGCGCGGCGACGATGGTGGCCGC
GGCGGCGGTAGTGGCAAGTGCCCCGAGGTCTGGGGGGCGGTCAAGGCGGAGCTGAACCAAAAGTTCATGACGGGCACCGAGTGCAACGGGCTCGCCAGGGCCGCCATCCGCGCCATCTTC
CACGACTGCGGCTCCTGGGACCAGTCGCAGGGGCTCGTCGGCGGCTGCGACGGCTCCCTCATCACGGGCGTCACGCCCGACGTCGAGCTAGACCGGCCCGAGAACAGGGGGCTGCAGACC
GTCGCCGCCTACCTCAAGGACGCCGCGGCCCGCCATGGAACGTCGGTCGCCGACATGATTGTCTTTGCCGGCA
GTGAGTGACTCTCCCCTAGCATGGGAATGTTTGGGATCAGCACGAAA
GCATGTTTTCAGAACTAACCAATGCCTACTCTCCTCCCCACCACCACCGCAGACGCAGCGACCGTGCTCTGCCCAGGCGGCCCGAGGGTCAAGACCTTCATCGGCCGCAAGGACAGCACC
AACTCGGCCAAGCCGGGCGGCCTGCCCGACGTGTTCGACACGGCCGCCAACCTGGTAGACCTTTTTGCCAAGAAGGGCTACAGCCAGGCCGAGCTCGCAGCCCTGATGGGCGCCCATAGC
ACCTCGACCCAGAGGTTTGTCGATCCGTCGCAGGCCGGCAAGGCCCAGGACTCGAC
GTAAGTACTTTTTTTTTTCTCCTTCATTGACCAAACCGTGTAATGACAGAGACTAATCGGTATC
CTCCCTCGAGGCAGACCCGGTCAATGGGATGTCAAGTACTACAAGGAGACCATCGACTACGCCAAGACGGGCAAGACGCCCAACAACGTCTTTGTGTTCCCCTCGGACGCCAAGCTGGCC
ACTTACCAGGACGTCGGCAAGAAGTTTGAGGGCTTTGTCAATAACCAGAACAAGTGGTCCAGCGCATTTGGAAACGC
GTAAGTTTGCACACCCCATGCATCCGCTTCTCGGTCAGTGTCG
CTAACGGCCTGCTCAACAGCATGGAGAAGATGGCCCTTTTCGGCAACGACAAGAACAACATGGTCGACTGCACCAACGCTCTGGGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTCAGCATCACCCTCGTCCTCCCCAGCCTCTTGGCGCTGGCCGGCGCCGTCCCGGGCCCCAAGGGCGGCGACGACAGCGGCAAGTCTGGCACGCGCGGCGACGATGGTGGCCGC
GGCGGCGGTAGTGGCAAGTGCCCCGAGGTCTGGGGGGCGGTCAAGGCGGAGCTGAACCAAAAGTTCATGACGGGCACCGAGTGCAACGGGCTCGCCAGGGCCGCCATCCGCGCCATCTTC
CACGACTGCGGCTCCTGGGACCAGTCGCAGGGGCTCGTCGGCGGCTGCGACGGCTCCCTCATCACGGGCGTCACGCCCGACGTCGAGCTAGACCGGCCCGAGAACAGGGGGCTGCAGACC
GTCGCCGCCTACCTCAAGGACGCCGCGGCCCGCCATGGAACGTCGGTCGCCGACATGATTGTCTTTGCCGGCA
ACGCAGCGACCGTGCTCTGCCCAGGCGGCCCGAGGGTCAAGACCTTC
ATCGGCCGCAAGGACAGCACCAACTCGGCCAAGCCGGGCGGCCTGCCCGACGTGTTCGACACGGCCGCCAACCTGGTAGACCTTTTTGCCAAGAAGGGCTACAGCCAGGCCGAGCTCGCA
GCCCTGATGGGCGCCCATAGCACCTCGACCCAGAGGTTTGTCGATCCGTCGCAGGCCGGCAAGGCCCAGGACTCGAC
ACCCGGTCAATGGGATGTCAAGTACTACAAGGAGACCATCGAC
TACGCCAAGACGGGCAAGACGCCCAACAACGTCTTTGTGTTCCCCTCGGACGCCAAGCTGGCCACTTACCAGGACGTCGGCAAGAAGTTTGAGGGCTTTGTCAATAACCAGAACAAGTGG
TCCAGCGCATTTGGAAACGC
CATGGAGAAGATGGCCCTTTTCGGCAACGACAAGAACAACATGGTCGACTGCACCAACGCTCTGGGCTAA

Retrieve as FASTA