Entry information : ChigCIIAC05 (VPL1)
Entry ID 8485
Creation 2011-08-25 (Christophe Dunand)
Last sequence changes 2011-08-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-10 (Christophe Dunand)
Peroxidase information: ChigCIIAC05 (VPL1)
Name (synonym) ChigCIIAC05 (VPL1)
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Colletotrichum
Organism Colletotrichum higginsianum    [TaxId: 80884 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ChigCIIAC05
start..stop
S start..stop
CgraCIIAC05 424 1e-150 44..319 34..312
CfioCIIAC_PJ7 361 7e-126 31..319 21..310
CfioCIIAC01_MH18 360 2e-125 36..319 26..310
GgrCIIAC01 355 9e-124 6..316 7..308
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..451 451 N° 2 553..796 244 N° 3 880..1068 189 N° 4 1143..1218 76
join(1..451,553..796,880..1068,1143..1218)


exon

Literature and cross-references ChigCIIAC05 (VPL1)
DNA ref. Broad_Colleto:   S7000006585852868 GenBank:   CACQ02005495.1
Protein sequence: ChigCIIAC05 (VPL1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (302)
PWM (Da):   %s   32658.3 (30823.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.35 (5.10) Peptide Signal:   %s   cut: 18 range:18-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRATDLVLAGLLALVNAIALPxPAAAAASSPSLSSSSSSSSLARDLEARAPNCPDVWKLVNADLNALFLEGGKCNALARGAISALFHDCGSxDQSQGLSGGCDGSLIAGVAPDVELDRIENRGLQNIAGALSDLAGKHNTTKADMIIFAGNAAVFLCPGGPKVRTYIGRKDNTNSATRGGLPSPFDTPENLLALFKAKGLDAEALAALLGAHSTSTQSFVNATQAGASQDSTPGELDVSYYKQTHDFATKGTAPAGVFVFPSDAGIATSEASSVGRWFQGFIGDQDKWSKSFKKSMERMALFGNDKGTMADCTDSIAKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCGCAACTGACCTTGTTCTCGCCGGCCTTTTGGCGCTCGTCAACGCCATCGCGCTGCCCGAMCCCGCGGCTGCCGCCGCCTCCTCTCCTTCTTTGTCTTCTTCTTCTTCTTCTTCC
TCTTTGGCCAGAGACCTCGAGGCACGCGCGCCGAACTGCCCTGACGTCTGGAAGCTGGTCAACGCCGACCTCAACGCCCTGTTCCTCGAGGGCGGGAAGTGCAACGCCCTCGCGAGGGGC
GCCATCAGCGCCCTCTTCCACGACTGCGGCTCGKGGGACCAGTCCCAGGGGCTCAGCGGCGGCTGCGACGGATCCCTGATCGCCGGCGTCGCGCCGGACGTCGAGCTCGACCGGATCGAG
AACAGGGGCCTGCAGAACATCGCGGGCGCATTGAGCGACCTGGCCGGGAAGCACAACACGACCAAGGCCGACATGATAATCTTCGCCGGGA
GTGAGTCTCGATCCCTTCGTGGTTGTTGG
CAACTTGAGCCCCTAAATCTTTGATTTTATTTCGTTTCTGAATATGTAACTGACTTTTCCTCCGTGTCCCAGACGCTGCTGTGTTCTTGTGTCCCGGCGGGCCCAAGGTCAGGACCTATA
TCGGCCGCAAGGACAACACGAACTCGGCCACGAGGGGCGGCTTGCCGAGCCCCTTTGACACCCCCGAGAACTTGCTGGCGCTGTTCAAGGCCAAGGGTCTCGATGCCGAGGCCCTCGCGG
CGCTGCTCGGCGCCCATAGCACCTCCACGCAGAGCTTCGTCAACGCGACGCAGGCGGGGGCGTCGCAGGACTCAAC
GTGAGTATCATTCTCAACCATGAAGGGCTGACGAATTGAGAAGG
GCTCGCTGACGTGATCCTCACCGAGGAACGAAAAAACAGACCCGGAGAGCTGGACGTCAGCTACTACAAGCAAACGCACGACTTTGCCACTAAAGGCACCGCGCCGGCGGGCGTCTTCGT
CTTCCCCTCGGACGCCGGCATCGCGACCTCGGAGGCGAGCAGCGTCGGCAGGTGGTTCCAGGGCTTCATCGGGGACCAGGACAAATGGAGCAAGAGCTTCAAGAAGTC
GTGAGTGATCTT
CCTGCTGCGCGTTAGCGGACGAACGGACGGACGGATGGACTAGTAGCTAACGCGGGCGACAGGATGGAGAGAATGGCCCTCTTTGGCAACGACAAGGGGACCATGGCTGACTGCACCGAC
TCGATAGCCAAGCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCGCAACTGACCTTGTTCTCGCCGGCCTTTTGGCGCTCGTCAACGCCATCGCGCTGCCCGAMCCCGCGGCTGCCGCCGCCTCCTCTCCTTCTTTGTCTTCTTCTTCTTCTTCTTCC
TCTTTGGCCAGAGACCTCGAGGCACGCGCGCCGAACTGCCCTGACGTCTGGAAGCTGGTCAACGCCGACCTCAACGCCCTGTTCCTCGAGGGCGGGAAGTGCAACGCCCTCGCGAGGGGC
GCCATCAGCGCCCTCTTCCACGACTGCGGCTCGKGGGACCAGTCCCAGGGGCTCAGCGGCGGCTGCGACGGATCCCTGATCGCCGGCGTCGCGCCGGACGTCGAGCTCGACCGGATCGAG
AACAGGGGCCTGCAGAACATCGCGGGCGCATTGAGCGACCTGGCCGGGAAGCACAACACGACCAAGGCCGACATGATAATCTTCGCCGGGA
ACGCTGCTGTGTTCTTGTGTCCCGGCGGG
CCCAAGGTCAGGACCTATATCGGCCGCAAGGACAACACGAACTCGGCCACGAGGGGCGGCTTGCCGAGCCCCTTTGACACCCCCGAGAACTTGCTGGCGCTGTTCAAGGCCAAGGGTCTC
GATGCCGAGGCCCTCGCGGCGCTGCTCGGCGCCCATAGCACCTCCACGCAGAGCTTCGTCAACGCGACGCAGGCGGGGGCGTCGCAGGACTCAAC
ACCCGGAGAGCTGGACGTCAGCTAC
TACAAGCAAACGCACGACTTTGCCACTAAAGGCACCGCGCCGGCGGGCGTCTTCGTCTTCCCCTCGGACGCCGGCATCGCGACCTCGGAGGCGAGCAGCGTCGGCAGGTGGTTCCAGGGC
TTCATCGGGGACCAGGACAAATGGAGCAAGAGCTTCAAGAAGTC
GATGGAGAGAATGGCCCTCTTTGGCAACGACAAGGGGACCATGGCTGACTGCACCGACTCGATAGCCAAGCTTTGA

Retrieve as FASTA