Entry information : ChigCIIAB07
Entry ID 8486
Creation 2011-08-25 (Christophe Dunand)
Last sequence changes 2012-11-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-11-06 (Christophe Dunand)
Peroxidase information: ChigCIIAB07
Name ChigCIIAB07
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Colletotrichum
Organism Colletotrichum higginsianum    [TaxId: 80884 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ChigCIIAB07
start..stop
S start..stop
CgraCIIAB07 416 2e-149 1..262 1..263
CgloCIIAB01_ST23 415 9e-149 1..262 1..261
CgloCIIAB01_Naragc5 413 4e-148 4..262 3..261
MgrCIIAB03 278 6e-95 27..261 30..264
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11942..12272 331 N° 2 11486..11873 388 N° 3 11360..11429 70  
complement(join(11360..11429,11486..11873,11942..12272))


exon

Literature and cross-references ChigCIIAB07
Protein ref. GenBank:   CCF47082.1 [Incorrect prediction]
Protein sequence: ChigCIIAB07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   263 (238)
PWM (Da):   %s   27944.71 (25283.3)  
PI (pH):   %s   5.75 (5.07) Peptide Signal:   %s   cut: 25 range:25-262
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSSYRLTSLLLAIILAFTATCHARSCPPVWNKVAADLRSSFAGCPSEARQAMRAAFHDCFPGSCDGSLILANECLDREENVQMQPICELLGEKAIAYNVSTADMIQAAAAFGVAACGGPRVYFFVGRKDSAIPNAEGTLPTQDSDAASQITAFKKKGFTATDLVALVGAHSAGQSIQELSFDSTPEKLDSTVFYPETFQEMTPTSLGSDVALSNSRETKNIWKGFGASQTRWNSAFKLAMAKMSIMGNDLGKLADCSKLVS*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTTCATACAGGCTTACTTCTTTATTACTTGCAATTATTCTTGCCTTTACCGCAACATGCCACGCACGATCCTGCCCCCCTGTATGGAACAAGGTTGCTGCAGACCTGAGAAGC
TCCTTTGCAGGATGTCCCTCCGAGGCGAGACAGGCAATGCGCGCCGCGTTCCATGATTGCTTCCCTGGATCCTGCGACGGCTCTCTGATCTTGGCCAACGAGTGTCTCGACAGGGAAGAG
AATGTACAGATGCAGCCCATCTGCGAGTTACTGGGCGAAAAGGCCATTGCCTACAACGTCAGCACCGCCGACATGATTCAAGCGGCAGCAG
GTAAGCGGCGTCATGCCAGCCGTCTGGCT
TGATGGATAGCATCGAGCTATGCTAACGGGAGCCCATAGCCTTCGGAGTTGCGGCCTGCGGGGGTCCCAGAGTCTACTTCTTCGTCGGGCGAAAGGATTCCGCTATACCTAATGCCGAGG
GCACGCTGCCCACGCAAGACTCCGACGCCGCCTCCCAGATAACCGCCTTCAAGAAGAAGGGCTTCACGGCCACGGATCTCGTGGCCCTCGTCGGGGCGCACAGCGCGGGTCAGAGCATCC
AGGAGCTGTCTTTCGATTCGACCCCCGAGAAGCTGGACAGCACCGTGTTCTACCCCGAGACGTTCCAAGAGATGACGCCGACCTCGTTGGGCAGCGACGTCGCCCTCAGCAACTCGCGGG
AGACCAAGAACATCTGGAAGGGGTTTGGGGCGAGCCAAACGCGGTGGAATTCCGCGTTCAAGCTGGC
GTGAGTTCGATGTCATTCGCATTGCTTGAAACTCTGTCACTAATCATTGTGAG
CAGGATGGCGAAGATGAGCATCATGGGAAACGACCTGGGGAAGCTTGCAGACTGCTCCAAACTGGTATCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTTCATACAGGCTTACTTCTTTATTACTTGCAATTATTCTTGCCTTTACCGCAACATGCCACGCACGATCCTGCCCCCCTGTATGGAACAAGGTTGCTGCAGACCTGAGAAGC
TCCTTTGCAGGATGTCCCTCCGAGGCGAGACAGGCAATGCGCGCCGCGTTCCATGATTGCTTCCCTGGATCCTGCGACGGCTCTCTGATCTTGGCCAACGAGTGTCTCGACAGGGAAGAG
AATGTACAGATGCAGCCCATCTGCGAGTTACTGGGCGAAAAGGCCATTGCCTACAACGTCAGCACCGCCGACATGATTCAAGCGGCAGCAG
CCTTCGGAGTTGCGGCCTGCGGGGGTCCC
AGAGTCTACTTCTTCGTCGGGCGAAAGGATTCCGCTATACCTAATGCCGAGGGCACGCTGCCCACGCAAGACTCCGACGCCGCCTCCCAGATAACCGCCTTCAAGAAGAAGGGCTTCACG
GCCACGGATCTCGTGGCCCTCGTCGGGGCGCACAGCGCGGGTCAGAGCATCCAGGAGCTGTCTTTCGATTCGACCCCCGAGAAGCTGGACAGCACCGTGTTCTACCCCGAGACGTTCCAA
GAGATGACGCCGACCTCGTTGGGCAGCGACGTCGCCCTCAGCAACTCGCGGGAGACCAAGAACATCTGGAAGGGGTTTGGGGCGAGCCAAACGCGGTGGAATTCCGCGTTCAAGCTGGC
G
ATGGCGAAGATGAGCATCATGGGAAACGACCTGGGGAAGCTTGCAGACTGCTCCAAACTGGTATCCTGA

Retrieve as FASTA