Entry information : HanCIIBB05
Entry ID 8496
Creation 2011-09-15 (Christophe Dunand)
Last sequence changes 2012-04-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-09-15 (Christophe Dunand)
Peroxidase information: HanCIIBB05
Name HanCIIBB05
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Bondarzewiaceae Heterobasidion
Organism Heterobasidion annosum (root rot fungus)    [TaxId: 13563 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HanCIIBB05
start..stop
S start..stop
HanCIIBB01 650 0 1..361 1..361
HanCIIBB02 583 0 1..361 1..356
HanCIIBB07 571 0 1..361 1..361
GsppCIIBB07 546 0 1..361 1..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1016781..1016832 52 N° 2 1016885..1017092 208 N° 3 1017151..1017285 135 N° 4 1017345..1017466 122
N° 5 1017528..1017603 76 N° 6 1017653..1017778 126 N° 7 1017846..1017925 80 N° 8 1017978..1018013 36
N° 9 1018074..1018246 173 N° 10 1018310..1018374 65 N° 11 1018427..1018439 13  
join(1016781..1016832,1016885..1017092,1017151..1017285,1017345..1017466,1017528 ..1017603,1017653..1017778,1017846..1017925,1017978..1018013,1018074..1018246,10 18310..1018374,1018427..1018439)


exon

Literature and cross-references HanCIIBB05
DNA ref. JGI genome:   scaffold_11 (1016781..1018439)
mRNA ref. JGI transcript:   10470
Protein sequence: HanCIIBB05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (343)
PWM (Da):   %s   37377.42 (35684.5)  
PI (pH):   %s   4.06 (4.06) Peptide Signal:   %s   cut: 19 range:19-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFGTLIAFAALIGASSAAITRRVACPDGVNTATNAACCALFAVRDDIQENLFDGGECGEDVHESLRLTFHDAIGFSLSANAAGTFGGGGADGSIIVFSSIETAFHANNGIDEIVEEQKPFIARHNITPGDFIQFAGAIGVSNCPGAPQLDFLLGRPAPVAPAPDLTVPEPDSVDSILARFNDTGFNAAEVVALLASHTIAAADKVDVTIPGTPFDSTPEMFDTQFFIETQLRGTLFPGTAGNQGEVMSPLAGELRLQSDSELADNRTACLWQANVNQLAHMTSTFKAAMAKLAVLGQDTSQMVDCSELIPTPPPFTGAAHLPAGLTSADIEQCSLTPFPTLPTDPGPITSVAPVPPS

Retrieve as FASTA  
Remarks Complete sqequence from genomic (10 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGGAACTCTCATCGCATTTGCTGCTCTCATTGGCGCCTCCAGCGGTCCGTACCATTGATATATTTTGATTCAATGTCCCTCTCACTCAGTCTTTAGCTGCTATTACGCGGCG
CGTTGCCTGCCCGGACGGGGTGAATACTGCTACCAACGCTGCTTGCTGCGCACTGTTTGCTGTCCGGGACGACATCCAGGAGAATCTGTTCGACGGCGGCGAATGTGGTGAAGACGTGCA
CGAGTCACTCCGTCTAACATTCCACGACGCTATTGGCTTCTCCCTCTCTGCTAATGCTGCGGGCACTTTCGG
GTTTGTGTTTCCATTTTATCCTGTGTATCCACGTCTCCATCTCACCTA
AATTTAATAGTGGTGGAGGTGCTGACGGTTCCATCATCGTATTCTCCTCCATTGAGACCGCATTCCATGCCAACAACGGCATTGACGAAATCGTGGAGGAACAGAAACCATTCATTGCTA
GACATAACATCACTCCTGGCGATTT
GTAGGTCCTTTCAGCTCAGCTCTACAAAACATGAATTTGACTAGCGACGCTATTCATAGCATCCAATTTGCTGGTGCAATTGGTGTGAGTAATTG
TCCCGGTGCCCCGCAGCTAGACTTTCTGCTTGGTCGCCCTGCCCCCGTGGCCCCCGCTCCTGACTTGACCGTCCCTGAACCCTTCG
GTGAGACTAATAAACCAATCACAGTAGTCTATTT
TCTGCAAGCTCACATCAATATCACCAGACTCGGTTGACAGTATTCTGGCCCGCTTCAATGACACAGGCTTCAATGCTGCTGAAGTCGTCGCATTGCTCGCGTCGTAAGTTCATTTGACTT
CTGCGCCGCTACCTTTCTCATATTTTTGCAAGCCACACCATTGCTGCTGCGGATAAGGTCGACGTGACGATCCCAGGAACTCCGTTCGACTCTACGCCTGAGATGTTCGATACTCAGTTC
TTCATTGAGACTCAGCTTCGTGGCACTCTTTTCCCAGG
GTACGACAGTCTTCTCATTTTTTCCCCGGGTCTGCTTCATGCATATTGTCATTATCTTGCCATGTAGAACTGCTGGAAACCA
GGGTGAAGTCATGTCGCCCTTGGCAGGAGAGCTGCGTCTCCAATCGGACTCGGAATTGGCTAGAG
GTCTGTTCACAAGTTTTTGTCGATAGGTTTTACTGACTCTGCACATGCTCAGACA
ATCGCACTGCTTGCTTGTGGCAGGCTAACGTCA
GTGAGTATGAACTCTTATTGCATCGCACTTATGGTTTTGATGCGTCTTTACACCGATGAGACCAACTTGCGCATATGACATCAACGT
TCAAAGCGGCTATGGCAAAGTTGGCTGTTCTAGGACAGGATACATCTCAGATGGTCGACTGTTCAGAACTAATCCCGACGCCTCCACCTTTCACTGGTGCTGCTCACCTACCTGCGGGCC
TGACAAGCGCTGATATCGAACAAGCC
GTGAGTCGTGATGAATGCTGCTGCAGGCTACTCCTATTGATGACCATCATACACCTCCCTAAGTGCTCACTTACTCCATTCCCCACCTTGCCGA
CTGACCCTGGTCCCATAACCTCGGTTGCTCCTGT
GTAAGTCAAATTGCCTCTAACTTCATGGCTGCTTTGCTCACTATTGGTACAGACCTCCCTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGGAACTCTCATCGCATTTGCTGCTCTCATTGGCGCCTCCAGCGCTGCTATTACGCGGCGCGTTGCCTGCCCGGACGGGGTGAATACTGCTACCAACGCTGCTTGCTGCGCA
CTGTTTGCTGTCCGGGACGACATCCAGGAGAATCTGTTCGACGGCGGCGAATGTGGTGAAGACGTGCACGAGTCACTCCGTCTAACATTCCACGACGCTATTGGCTTCTCCCTCTCTGCT
AATGCTGCGGGCACTTTCGG
TGGTGGAGGTGCTGACGGTTCCATCATCGTATTCTCCTCCATTGAGACCGCATTCCATGCCAACAACGGCATTGACGAAATCGTGGAGGAACAGAAACCA
TTCATTGCTAGACATAACATCACTCCTGGCGATTT
CATCCAATTTGCTGGTGCAATTGGTGTGAGTAATTGTCCCGGTGCCCCGCAGCTAGACTTTCTGCTTGGTCGCCCTGCCCCCGTG
GCCCCCGCTCCTGACTTGACCGTCCCTGAACCCTTCG
ACTCGGTTGACAGTATTCTGGCCCGCTTCAATGACACAGGCTTCAATGCTGCTGAAGTCGTCGCATTGCTCGCGTCCCACACC
ATTGCTGCTGCGGATAAGGTCGACGTGACGATCCCAGGAACTCCGTTCGACTCTACGCCTGAGATGTTCGATACTCAGTTCTTCATTGAGACTCAGCTTCGTGGCACTCTTTTCCCAGG
A
ACTGCTGGAAACCAGGGTGAAGTCATGTCGCCCTTGGCAGGAGAGCTGCGTCTCCAATCGGACTCGGAATTGGCTAGAG
ACAATCGCACTGCTTGCTTGTGGCAGGCTAACGTCAACCAA
CTTGCGCATATGACATCAACGTTCAAAGCGGCTATGGCAAAGTTGGCTGTTCTAGGACAGGATACATCTCAGATGGTCGACTGTTCAGAACTAATCCCGACGCCTCCACCTTTCACTGGT
GCTGCTCACCTACCTGCGGGCCTGACAAGCGCTGATATCGAACAAGCC
TGCTCACTTACTCCATTCCCCACCTTGCCGACTGACCCTGGTCCCATAACCTCGGTTGCTCCTGTACCTCCC
TCTTGA

Retrieve as FASTA