Entry information : HanCIIBA
Entry ID 8498
Creation 2011-09-15 (Christophe Dunand)
Last sequence changes 2011-09-15 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-11-07 (Christophe Dunand)
Peroxidase information: HanCIIBA
Name HanCIIBA
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Bondarzewiaceae Heterobasidion
Organism Heterobasidion annosum (root rot fungus)    [TaxId: 13563 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HanCIIBA
start..stop
S start..stop
ParcCIIBA04 541 0 23..358 26..361
ParcCIIBA06 541 0 14..361 14..361
CuniCIIBA04 538 0 1..361 1..363
DsCIIBA04 535 0 1..361 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 898792..898899 108 N° 2 898693..898735 43 N° 3 898624..898644 21 N° 4 898547..898563 17
N° 5 898486..898494 9 N° 6 898372..898430 59 N° 7 898303..898316 14 N° 8 898208..898249 42
N° 9 898070..898148 79 N° 10 897776..898016 241 N° 11 897671..897724 54 N° 12 897501..897616 116
N° 13 897417..897445 29 N° 14 897297..897361 65 N° 15 897135..897245 111 N° 16 897039..897078 40
N° 17 896951..896975 25 N° 18 896882..896894 13  
complement(join(896882..896894,896951..896975,897039..897078,897135..897245,8972 97..897361,897417..897445,897501..897616,897671..897724,897776..898016,898070..8 98148,898208..898249,898303..898316,898372..898430,898486..898494,898547..898563 ,898624..898644,898693..898735,898792..898899))


exon

Literature and cross-references HanCIIBA
DNA ref. JGI genome:   scaffold_14 (898899..896882)
mRNA ref. JGI transcript:   108376
Protein sequence: HanCIIBA
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361
PWM (Da):   %s   37878.86  
PI (pH):   %s   4.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSWKAIAALTALVVSAIAAPSRRVSCGDGRTASNAVCCTWFNVLDDIQENLFDGGECGEEVHESLRLTFHDAIGFSEKLTREGKFGGGGADGSIMAFADIETNFHANIGVDEIVEAQRPFALAHKVSFGDFIQFAGAVGVSNCAGGPRLQFLAGRSNHSRVSPDLLVPEPSDSADTIFARMADAGFSITDTVDLLISHTVAAQDHVDPTIPGTPFDSTPSSFDAQFFVETLLAGSIFPGNGSNVGEVLSPLGGEFRLQSDFVISRDARSACEWQSLISNHERMVSKFESVMSRLATVGQNPRSLVDCSEVIPVPKAVKLPAPTLPAGKTISDIQAACAATPFPRLQAAPGPATTIPAVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (17 introns). Intron 13 is not included in a Cintron 897417..897445,897501..897616
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTGGAAAGCCATCGCTGCTCTGACTGCCCTTGTTGTCTCTGCCATCGCTGCGCCTTCAAGGCGCGTCTCTTGTGGCGATGGAAGGACGGCTAGCAATGCTGTGGTACAATTCCAT
CGCCATTGATCATCCCACCAGATTCCTCACGTCCACACTACAGTGCTGCACTTGGTTCAACGTCTTGGACGACATTCAAGAGAATCTGTAAGGCAGTGTTTGATTAATCGTTACTTCAGC
TCTGACCAAATCTTAGTTTCGATGGTGGAGAGTGCGGTGAGTCTCTGAACGAGAACAAGTAGTCTTACACATTTGTTTGACCGTTTGACTTCCCAGGCGAGGAGGTTCACGAGGTATGTG
AAATTTTATTGTTGCCTACTTTCCCATCTGACCGATAGTCTTTAGTCCTTGCGTGTAAGGTTCCATGACATTCAAAATTCATCATAAATAAAACGTCATCGCTTCGCAGCTGACTTTCCA
CGATGCCATTGGCTTCTCCGAGAAGCTGACACGGGAAGGGAAATTCGG
GTGGGTATTCATTTTTTCGATCTCTTTTTATATATCCTGATGTGCATCGGCGCAGTGGCGGAGGAGCTGGTA
TATATTTTCCTTCTTACTATCATACCTCTGCTCACAGGCTACCCTTTTAGATGGTTCCATCATGGCTTTCGCGGACATTGAAACAAATTTCCGTCAGTGATTTCCTACTGACTTTTCTCG
CCTCTGGGGTTTTGATTGCCTATCATTGCAGACGCTAATATTGGAGTTGACGAGATTGTCGAGGCCCAGCGTCCATTCGCACTGGCGCACAAGGTGTCCTTTGGTGACTTGTATGTCCAC
AGCTTCCCACCTTTCTCACGGCACTTATGCTCCCCACCAATAGCATCCAATTTGCTGGAGCTGTGGGTGTCTCCAACTGTGCCGGTGGTCCACGCCTGCAGTTCTTGGCTGGTCGCTCCA
ACCACTCCCGTGTATCCCCAGACCTCCTGGTTCCAGAACCTAGCGACTCCGCCGATACAATCTTCGCTCGGATGGCCGATGCAGGCTTCAGTATCACCGATACTGTGGACTTGCTGATCT
CCCACACCGTCGCGGCGCAAGATCACGTTGACCCCACCATTCCG
GTAGAATCTATCCATGTCAATCAATGAAATTGATCCTTACGTTTTTACTAGGGAACACCTTTCGACTCAACCCCGA
GCAGCTTCGACGCGCAGTTCTTTGTTGAG
GTGAGTCAAATGATATCATTTAAATCAGGGATGTTCGAGCTAATACGTCAATAGACCCTTCTCGCTGGTAGCATTTTCCCTGGCAATGGGT
CCAACGTTGGCGAAGTTCTTTCCCCCCTGGGCGGTGAATTCCGCCTCCAGTCAGACTTCGTAATTTCCAGGGATGCTCG
GTACGAACTCCTCTTTTGAGACCTTGAAACTGGCCTTACAT
GTCGCATGTTCTAGATCTGCTTGCGAATGGCAGTCCCTCATCTGTAAGTGGATGTTTTTCACGCTCCTCCGAGGCTTACTTATATATTATTTTCACAGCCAACCACGAACGAATGGTCTC
CAAATTTGAGAGTGTAATGAGTCGTCTTGCCACTGTCGGACAG
GTCAGTGCTTCCGGCACTTGTATGACGATTGCTATACATAAATATCCACAGAACCCACGGTCCTTGGTTGATTGTTC
CGAGGTCATTCCCGTTCCGAAAGCCGTCAAGCTTCCCGCCCCGACGCTCCCTGCTGGTAAAACTATTAGCGATATCCAGGCTGCT
GTATGTGTCCATCTTTCAACCTGTGACCAATATCT
GACTCTTTGTGAAATTCTCAGTGCGCGGCTACCCCTTTCCCGAGGCTTCAAGCGGCCCCTGGTCAGTCTTCGAGTCATTCACTGGCTACGTTTTGTGCTGATTTCTGTCATCCGCATTAT
ACAGGTCCAGCGACGACCATTCCTGCAGTGTGAGTATAAATCATCTCAATTTCACCCGTTCTTGTGCTGACTTCGAGGCCATCAGTCCTCCCTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTGGAAAGCCATCGCTGCTCTGACTGCCCTTGTTGTCTCTGCCATCGCTGCGCCTTCAAGGCGCGTCTCTTGTGGCGATGGAAGGACGGCTAGCAATGCTGTGGCTGCACTTGGT
TCAACGTCTTGGACGACATTCAAGAGAATCT
GTTTCGATGGTGGAGAGTGCGGCGAGGAGGTTCACGAGTCCTTGCGTCTGACTTTCCACGATGCCATTGGCTTCTCCGAGAAGCTGACA
CGGGAAGGGAAATTCGG
TGGCGGAGGAGCTGATGGTTCCATCATGGCTTTCGCGGACATTGAAACAAATTTCCACGCTAATATTGGAGTTGACGAGATTGTCGAGGCCCAGCGTCCATTC
GCACTGGCGCACAAGGTGTCCTTTGGTGACTT
CATCCAATTTGCTGGAGCTGTGGGTGTCTCCAACTGTGCCGGTGGTCCACGCCTGCAGTTCTTGGCTGGTCGCTCCAACCACTCCCGT
GTATCCCCAGACCTCCTGGTTCCAGAACCTAGCGACTCCGCCGATACAATCTTCGCTCGGATGGCCGATGCAGGCTTCAGTATCACCGATACTGTGGACTTGCTGATCTCCCACACCGTC
GCGGCGCAAGATCACGTTGACCCCACCATTCCG
GGAACACCTTTCGACTCAACCCCGAGCAGCTTCGACGCGCAGTTCTTTGTTGAGACCCTTCTCGCTGGTAGCATTTTCCCTGGCAAT
GGGTCCAACGTTGGCGAAGTTCTTTCCCCCCTGGGCGGTGAATTCCGCCTCCAGTCAGACTTCGTAATTTCCAGGGATGCTCG
ATCTGCTTGCGAATGGCAGTCCCTCATCTCCAACCAC
GAACGAATGGTCTCCAAATTTGAGAGTGTAATGAGTCGTCTTGCCACTGTCGGACAG
AACCCACGGTCCTTGGTTGATTGTTCCGAGGTCATTCCCGTTCCGAAAGCCGTCAAGCTTCCC
GCCCCGACGCTCCCTGCTGGTAAAACTATTAGCGATATCCAGGCTGCT
TGCGCGGCTACCCCTTTCCCGAGGCTTCAAGCGGCCCCTGGTCCAGCGACGACCATTCCTGCAGTTCCTCCC
TCTTAG

Retrieve as FASTA