Entry information : ShirCIIBC03
Entry ID 8501
Creation 2011-09-20 (Christophe Dunand)
Last sequence changes 2011-09-20 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-30 (Nizar Fawal)
Peroxidase information: ShirCIIBC03
Name ShirCIIBC03
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Stereaceae Stereum
Organism Stereum hirsutum    [TaxId: 40492 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ShirCIIBC03
start..stop
S start..stop
ShirCIIBC04 597 0 1..357 1..358
ShirCIIBC02 575 0 1..357 1..360
ShirCIIBC06 565 0 1..357 1..352
ShirCIIBC05 553 0 1..354 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 553238..553364 127 N° 2 553121..553185 65 N° 3 552940..553057 118 N° 4 552679..552879 201
N° 5 552486..552621 136 N° 6 552360..552425 66 N° 7 552221..552300 80 N° 8 552041..552165 125
N° 9 551887..551964 78 N° 10 551762..551826 65 N° 11 551692..551704 13  
complement(join(551692..551704,551762..551826,551887..551964,552041..552165,5522 21..552300,552360..552425,552486..552621,552679..552879,552940..553057,553121..5 53185,553238..553364))


exon

Literature and cross-references ShirCIIBC03
DNA ref. JGI genome:   scaffold_17 (553364..551692)
Cluster/Prediction ref. JGI gene:   6216
Protein sequence: ShirCIIBC03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (335)
PWM (Da):   %s   37557.66 (35336.5)  
PI (pH):   %s   4.22 (4.22) Peptide Signal:   %s   cut: 23 range:23-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFAQLSTLIALVFGAAQFVAAAPPRKIRCADGNVTSNAVCCQLFPVVANLQENLFDGAQCGEAHSALRLSFHDAIGFSIHGGKGGGADGSILAFNDTELQFHANGGIDDIVAGQFPVFQTTNLSPGDFVHLAAAVGTANCPGAPQLEFFFGRPPPKAPAPDLTVPEPTDSVDAIIERFADAGFAPDEIVALLSSHTVAAADVVDVTIPGTPFDSTPFTFDTQIFVETLLVGTLFPGNGSQSGEVLSPIPGEMRLQSDFELADPRTACLWQAMINDQTRMQTQFKAAMAKLEVLGQRNLVDCSVVPVPPPFRGQAMFPATFSRRDIQQACQATPFPTLETIPGPETSVPPVPGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTCAACTCTCAACTCTCATCGCTCTTGTCTTCGGCGCCGCCCAGTTCGTCGCGGCTGCTCCACCCAGGAAGATTAGGTGTGCTGACGGAAACGTCACATCCAACGCTGTC
TGTTGTC
GTGAGTCGGCTTCATTCTATCCCCACCAACTATTCTGATGTTGTCGCAACAGAGTTGTTCCCCGTCGTTGCAAACCTACAAGAGAACTTGTTCGACGGTGCTCAATGTGGTGA
AGAG
GTAATGCCATATTCCCTGGGCTTATCGAGAAATCTTCATGCTGACTATCGTTCTCGTTGGCAGGCGCACTCTGCTCTCCGCCTCTCCTTCCACGATGCCATCGGGTTCTCGATCCA
CGGCGGCAAGGGTGGAGGTGCTGATGGTTCCATCTTAGCTTTCAACGACACCGAGCTGCAATTCC
GTAGGTTATCGAATATCGCACATCTTTCTTCAGTTTGAGCTCACGTAACGGTCTT
TACAGACGCCAACGGTGGTATTGACGACATCGTCGCCGGCCAGTTCCCGGTGTTCCAGACAACCAACCTCTCCCCAGGTGACTTCGTCCACCTCGCTGCCGCGGTCGGTACTGCGAACTG
CCCTGGTGCTCCTCAGCTCGAATTCTTCTTCGGGCGCCCTCCCCCCAAGGCACCCGCTCCCGATCTCACTGTCCCCGAACCCACCG
GTATGTTTCTGTAGTCTCGTTGTTTCTGTATTTT
ATTCTTACAGTATGATTTTCTAGACTCCGTCGACGCTATCATTGAGAGGTTCGCAGATGCTGGCTTCGCCCCAGACGAGATTGTCGCTCTTCTGTCGTCTCACACTGTTGCTGCTGCCGA
TGTCGTTGATGTGACAATCCCTGGAACTCCCTTCGACTC
GTGAGTACTGGTGGCGCATGCTGATGTATTGCATGTTACTGACCAGAACACTACCTCTAGGACACCCTTCACCTTCGACAC
ACAGATCTTCGTTGAGACCTTGTTGGTTGGTACGCTGTTCCCAGG
GTAAGCCTTCATCTCTCGCCTATAACTTTGATTTTGTGCTCATATTTTATGCCATCCAGAAACGGCTCCCAGTCC
GGTGAAGTATTGTCCCCCATTCCCGGAGAGATGCGTCTTCAGAGTGACTTCGAACTCGCCCGTG
GTATGTCCTTACTCCAATTGTACCGCCATGTTGACAATATTAATGATGACCTCAGA
CCCAAGGACCGCCTGTCTTTGGCAGGCCATGATCAACGACCAGACTCGCATGCAGACGCAATTCAAGGCCGCCATGGCCAAGCTCGAAGTCCTCGGCCAGAGAAACCTTGTAGACTGCTC
TGAT
GTACGTTCATCCTGTTGCTTTAAGTCTTGGACCGGGCCGGCTTCTAACTATTACCCACATCTCGCTCCATACATAGGTCGTCCCCGTTCCCCCTCCCTTCAGAGGCCAGGCCATGT
TCCCCGCCACGTTCTCCCGCAGGGATATTCAGCAGGCT
GTACGCCTCATAGTTTCATCCGAATGCTCTTATTCGTACTCACCTATCCTTCCCAAATAGTGCCAGGCGACTCCCTTCCCCA
CCCTTGAGACCATCCCGGGTCCCGAGACCTCCGTACCCCCCGT
GTAAGCACCTATCCCATACAATTCTGCCGTTATGTGCTGATGATTTTTGGTTTTCAGTCCCGGCTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTCAACTCTCAACTCTCATCGCTCTTGTCTTCGGCGCCGCCCAGTTCGTCGCGGCTGCTCCACCCAGGAAGATTAGGTGTGCTGACGGAAACGTCACATCCAACGCTGTC
TGTTGTC
AGTTGTTCCCCGTCGTTGCAAACCTACAAGAGAACTTGTTCGACGGTGCTCAATGTGGTGAAGAGGCGCACTCTGCTCTCCGCCTCTCCTTCCACGATGCCATCGGGTTCTCG
ATCCACGGCGGCAAGGGTGGAGGTGCTGATGGTTCCATCTTAGCTTTCAACGACACCGAGCTGCAATTCC
ACGCCAACGGTGGTATTGACGACATCGTCGCCGGCCAGTTCCCGGTGTTC
CAGACAACCAACCTCTCCCCAGGTGACTTCGTCCACCTCGCTGCCGCGGTCGGTACTGCGAACTGCCCTGGTGCTCCTCAGCTCGAATTCTTCTTCGGGCGCCCTCCCCCCAAGGCACCC
GCTCCCGATCTCACTGTCCCCGAACCCACCG
ACTCCGTCGACGCTATCATTGAGAGGTTCGCAGATGCTGGCTTCGCCCCAGACGAGATTGTCGCTCTTCTGTCGTCTCACACTGTTGCT
GCTGCCGATGTCGTTGATGTGACAATCCCTGGAACTCCCTTCGACTC
GACACCCTTCACCTTCGACACACAGATCTTCGTTGAGACCTTGTTGGTTGGTACGCTGTTCCCAGGAAACGGC
TCCCAGTCCGGTGAAGTATTGTCCCCCATTCCCGGAGAGATGCGTCTTCAGAGTGACTTCGAACTCGCCCGTG
ACCCAAGGACCGCCTGTCTTTGGCAGGCCATGATCAACGACCAGACT
CGCATGCAGACGCAATTCAAGGCCGCCATGGCCAAGCTCGAAGTCCTCGGCCAGAGAAACCTTGTAGACTGCTCTGAT
GTCGTCCCCGTTCCCCCTCCCTTCAGAGGCCAGGCCATGTTC
CCCGCCACGTTCTCCCGCAGGGATATTCAGCAGGCT
TGCCAGGCGACTCCCTTCCCCACCCTTGAGACCATCCCGGGTCCCGAGACCTCCGTACCCCCCGTTCCCGGCTCTTAA

Retrieve as FASTA