Entry information : ShirCIIBC02
Entry ID 8502
Creation 2011-09-20 (Christophe Dunand)
Last sequence changes 2011-09-20 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-26 (Nizar Fawal)
Peroxidase information: ShirCIIBC02
Name ShirCIIBC02
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Stereaceae Stereum
Organism Stereum hirsutum    [TaxId: 40492 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ShirCIIBC02
start..stop
S start..stop
ShirCIIBC03 575 0 1..360 1..357
ShirCIIBC04 573 0 1..360 1..358
ShirCIIBC06 551 0 1..360 1..352
ShirCIIBC05 539 0 1..357 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 521167..521296 130 N° 2 520973..521099 127 N° 3 520861..520916 56 N° 4 520601..520801 201
N° 5 520448..520542 95 N° 6 520338..520393 56 N° 7 520229..520279 51 N° 8 520056..520135 80
N° 9 519770..519978 209 N° 10 519638..519702 65 N° 11 519548..519560 13  
complement(join(519548..519560,519638..519702,519770..519978,520056..520135,5202 29..520279,520338..520393,520448..520542,520601..520801,520861..520916,520973..5 21099,521167..521296))


exon

Literature and cross-references ShirCIIBC02
DNA ref. JGI genome:   scaffold_17 (521296..519548)
Cluster/Prediction ref. JGI gene:   7639
Protein sequence: ShirCIIBC02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360 (338)
PWM (Da):   %s   37189.31 (34923.1)  
PI (pH):   %s   4.05 (4.05) Peptide Signal:   %s   cut: 23 range:23-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFTQLSAFVSVVLAATQLSNAVAVNKRVTCADGNVTANAVCCQLFPAVANLQQNLFDGAQCGEEAHSALRLSFHDAIGFSINGGKGGGADGSILAFNSTELQHANSGIDDIVAGQFPVFQTTNLTAGDFVHLAAAVGTANCPGAPQLDFFFGRAPPVAPAPDLTVPEPTDSVDAIIARFADAGFAPDEIVALLSSHTVAADVVDVTIPGTPFDSTPFTFDTQFFVETQLKGTLFPGNGSQSGEVLSPIPGEMRLQSDFELSDSRTACLWQAMVNDQTRMTTQFKAAMHKLELLGQPDTLVDCSDVVPVPPALNAMSAALPAGFSAADVQGCQATPFPTLPTIPGPETSVPPVPGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCACTCAACTCTCCGCCTTCGTCTCTGTTGTGCTCGCTGCGACCCAGCTTTCCAACGCGGTCGCCGTCAACAAGCGCGTCACTTGCGCGGACGGCAACGTTACGGCTAACGCT
GTCTGCTGTC
GTGAGCATCTCTTGCCTCATCATCACATCCACATTGAGTCGGCAATTGAATGAATTGGTTTCTATAGAACTTTTCCCTGCTGTGGCCAACCTCCAGCAGAACTTGTTCGA
CGGCGCTCAGTGCGGTGAAGAGGCTCACTCCGCTCTCCGTCTCTCTTTCCACGACGCTATCGGGTTCTCGATCAACGGTGGAAA
GTCAGTCGCATCGCACTAACTTCCTTCATAATCCTA
CCATACTCAACTTCCTACAGGGGTGGAGGTGCAGACGGTTCTATCTTGGCTTTCAACAGCACGGAACTCCAATTCCGTATGTCGCTATACGCGTTCTCCCCATCGATTATCTCCTTACAC
GAATCACCTCTGCAGACGCCAACTCTGGTATCGATGATATCGTCGCCGGTCAATTCCCCGTCTTCCAGACCACGAACCTGACCGCCGGTGACTTCGTCCACCTTGCTGCCGCTGTCGGAA
CCGCGAACTGCCCTGGTGCTCCCCAGCTCGACTTCTTCTTCGGTCGTGCCCCACCGGTGGCCCCCGCTCCCGACCTTACGGTACCAGAGCCCACCG
GTATGTTCCGATATTTCTGACATT
CCATGTTCTTCCTTCTAATACAGAAATACTGCAGACTCCGTCGACGCCATCATTGCGAGGTTCGCCGATGCTGGCTTCGCTCCCGACGAGATCGTTGCTCTCCTGTCGTCTCACACCGTC
GCTGCCGCC
GTACGCCTTTGTTGTCGCATACCAGCGCACTCGCACTAACGCACTCCTCTCCAGGATGTTGTTGACGTTACCATCCCCGGAACCCCCTTCGACTCGACCCCCTTCACCTTG
TGAGTTGCTTGATCCTATCCTAATAATATCTCACTAGGCGCTGACCAAACCCTCCAGCGACACCCAGTTCTTCGTCGAGACTCAATTGAAGGGCACTCTGTTCCCCGGGTACGTTTGCTT
CTGTCACACCTGCTCGTGGCAGCACCTTATTTGGCATCGCATCACTTAACGCCGCATTCTTCCACTCTCTCACGCACACAGTAACGGCTCCCAGTCCGGAGAGGTGCTCTCTCCCATCCC
TGGTGAGATGCGTCTGCAGAGCGACTTCGAGCTCTCTCGCG
GTACGTCACCGCCCTTACCTCTTTCCGCACGCACTCACTCACTCACACTACCCCTTGTGATGAATTGTGGTACACAGAC
AGCAGAACCGCCTGCTTGTGGCAAGCCATGGTGAACGACCAGACCCGCATGACCACCCAGTTCAAGGCAGCCATGCACAAGCTCGAGCTCCTCGGCCAACCCGACACCCTCGTCGACTGC
TCCGATGTCGTCCCTGTTCCCCCGGCTCTTAACGCTATGAGCGCCGCCCTCCCCGCTGGGTTCAGCGCTGCCGATGTCCAGGGTGCT
GTATGTCATTTTTCTTCCATTCGTATATAAACA
ACTGATAGCTGACGGCGGTCGGGCTTGTGATTAGTGCCAAGCTACGCCCTTCCCGACGCTCCCCACCATCCCTGGCCCGGAGACTTCCGTTCCCCCCGTGTACGCCCCCTTCCATCTACT
CTCATCCCTCTGCTTCTGCTCGAGTTCAGGATACTAACCCATCCTTCGTTCTATAGCCCCGGCTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCACTCAACTCTCCGCCTTCGTCTCTGTTGTGCTCGCTGCGACCCAGCTTTCCAACGCGGTCGCCGTCAACAAGCGCGTCACTTGCGCGGACGGCAACGTTACGGCTAACGCT
GTCTGCTGTC
AACTTTTCCCTGCTGTGGCCAACCTCCAGCAGAACTTGTTCGACGGCGCTCAGTGCGGTGAAGAGGCTCACTCCGCTCTCCGTCTCTCTTTCCACGACGCTATCGGGTTC
TCGATCAACGGTGGAAA
GGGTGGAGGTGCAGACGGTTCTATCTTGGCTTTCAACAGCACGGAACTCCAATTCCACGCCAACTCTGGTATCGATGATATCGTCGCCGGTCAATTCCCCGTC
TTCCAGACCACGAACCTGACCGCCGGTGACTTCGTCCACCTTGCTGCCGCTGTCGGAACCGCGAACTGCCCTGGTGCTCCCCAGCTCGACTTCTTCTTCGGTCGTGCCCCACCGGTGGCC
CCCGCTCCCGACCTTACGGTACCAGAGCCCACCG
ACTCCGTCGACGCCATCATTGCGAGGTTCGCCGATGCTGGCTTCGCTCCCGACGAGATCGTTGCTCTCCTGTCGTCTCACACCGTC
GCTGCCGCC
GATGTTGTTGACGTTACCATCCCCGGAACCCCCTTCGACTCGACCCCCTTCACCTTCGACACCCAGTTCTTCGTCGAGACTCAATTGAAGGGCACTCTGTTCCCCGGTAAC
GGCTCCCAGTCCGGAGAGGTGCTCTCTCCCATCCCTGGTGAGATGCGTCTGCAGAGCGACTTCGAGCTCTCTCGCG
ACAGCAGAACCGCCTGCTTGTGGCAAGCCATGGTGAACGACCAG
ACCCGCATGACCACCCAGTTCAAGGCAGCCATGCACAAGCTCGAGCTCCTCGGCCAACCCGACACCCTCGTCGACTGCTCCGATGTCGTCCCTGTTCCCCCGGCTCTTAACGCTATGAGC
GCCGCCCTCCCCGCTGGGTTCAGCGCTGCCGATGTCCAGGGTGCT
TGCCAAGCTACGCCCTTCCCGACGCTCCCCACCATCCCTGGCCCGGAGACTTCCGTTCCCCCCGTCCCCGGCTCT
TAA

Retrieve as FASTA