Entry information : ShirCIIBC04
Entry ID 8503
Creation 2011-09-20 (Christophe Dunand)
Last sequence changes 2011-09-20 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-26 (Nizar Fawal)
Peroxidase information: ShirCIIBC04
Name ShirCIIBC04
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Stereaceae Stereum
Organism Stereum hirsutum    [TaxId: 40492 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ShirCIIBC04
start..stop
S start..stop
ShirCIIBC06 593 0 1..358 1..352
ShirCIIBC05 585 0 1..355 1..350
ShirCIIBC03 583 0 1..358 1..357
ShirCIIBC02 559 0 1..358 1..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 649787..649913 127 N° 2 649659..649723 65 N° 3 649547..649601 55 N° 4 649486..649492 7
N° 5 649375..649430 56 N° 6 649306..649318 13 N° 7 648970..649252 283 N° 8 648895..648909 15
N° 9 648800..648840 41 N° 10 648693..648743 51 N° 11 648557..648636 80 N° 12 648464..648499 36
N° 13 648237..648406 170 N° 14 648116..648180 65 N° 15 648043..648055 13  
complement(join(648043..648055,648116..648180,648237..648406,648464..648499,6485 57..648636,648693..648743,648800..648840,648895..648909,648970..649252,649306..6 49318,649375..649430,649486..649492,649547..649601,649659..649723,649787..649913 ))


exon

Literature and cross-references ShirCIIBC04
DNA ref. JGI genome:   scaffold_17 (649913..648043)
Cluster/Prediction ref. JGI gene:   10631
Protein sequence: ShirCIIBC04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (336)
PWM (Da):   %s   37892.69 (35759.5)  
PI (pH):   %s   4.01 (3.97) Peptide Signal:   %s   cut: 23 range:23-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFAQLSAIVALALGAVHVAQAAPPPKVTCADGNVTANAVCCQLFPVVANLQENLFDGAQCGEAHSALRLSFHDAIGWSNFVDKGDGADGSILVFNATELQHANIGIDDITSVQFPVFQTTNLSAGDFVHLAAAVGTANCPGAPQLDFFFGRPPPTEPAADLTVPEPTDSVDAIIERFTDAGFEVPEIVALLSSHTVAADEIDTTIPGTPFDTTPFTFDTQFFVETLLKGSLFPGNGSQAGEVLSPIPGEMRLQSDFELSDSRTACLWQAMINDQTRMQTQFKAVMHKLELLGQPDTLVDCSDVIPVPAPFKGQAVFPATFSRRDIQQCDTEPFPTLQTLPGPETSVPPVPGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (14 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTGCTCAGCTTTCCGCCATCGTCGCTCTCGCTCTTGGCGCAGTCCATGTCGCTCAGGCCGCTCCTCCACCGAAGGTTACCTGCGCCGACGGAAATGTCACCGCTAACGCTGTC
TGTTGCC
GTCAGTAACGTTTCCCTCATTACTGTTATGCCTAGTGTGTGTAAACTAATTTTCTTGCTATAGAGCTGTTCCCCGTCGTTGCCAATCTCCAAGAGAACCTGTTCGACGGTGCT
CAGTGCGGTGAAGAG
GTTCGAACAGGTTCTACTTGGACGAATACACTGATCCTGACTGGTTGGAATTATTAGGCTCACTCTGCTCTTCGTCTGAGCTTCCACGACGCGATTGGCTGGTCG
AATTTCG
GTGAGCACTCCTGCTTAGACATCGGATGATACTCTCACTGACCTCTCTCGACAGTTGATAAGTTCGTGACTTCGTCGTTCCACTTGGTTTCCATCTACTCATCATGTATATCA
CAGGGGTGATGGCGCCGACGGTTCCATCTTGGTGTTCAACGCCACTGAGTTGCAATTCCGTGAGTGGTTATCACTCGTCTCATTTGTAATATTTCTCTGACTTACAGTTCAACAGACGCC
AACATTGG
GTCAGTCTTATTCCTGAGAATTGACATGGATCGATGTTGACATTTTCCCACAGAATTGACGACATCACCTCCGTGCAATTCCCTGTCTTCCAGACCACGAACTTGTCCGCTG
GTGACTTCGTCCACTTGGCTGCCGCTGTCGGGACGGCCAATTGCCCCGGCGCTCCTCAGCTCGACTTCTTCTTTGGTCGTCCCCCGCCTACGGAGCCCGCTGCTGATCTGACTGTACCCG
AGCCCACGGACTCTGTTGACGCTATCATTGAGAGGTTCACCGATGCCGGCTTCGAGGTCCCTGAGATCGTGGCCCTGCTATCGTCCCACACCGTCGCTGCTGCG
GTATGTTCGATTTCAT
CTAGTCGTTCCATTGATACATAAGCTGATAGATGGACTCTATAGGACGAGATCGACACGGTATGTCATTGAGAGATGTTAGTAAGGTCTGCCTAACTGAATGTCACCAACTAGACCATTC
CCGGGACTCCTTTCGACACCACCCCTTTCACCTT
GTAAGAATCGTCGTGTGCTCAAGGCATAATATCCATACTCACACGAATGATCTAAGTGACACTCAGTTCTTCGTTGAGACCTTGTT
GAAGGGGTCGTTGTTCCCCGG
GTACGTTATCCGCTCACTCTTCTGGGGCCGTTCTCTGATGCTTCTTTTTTCCCTAGCAATGGCTCTCAAGCTGGTGAAGTTTTATCGCCCATCCCCGGA
GAGATGCGTCTTCAGTCCGACTTTGAGCTCTCCCGTG
GTAAGTGTCCTCGGCCAGATGTTCCAGTGAAAGCGATCCTAATCTTTGTTTCGACAGACTCCCGTACTGCTTGCTTGTGGCAG
GCTATGATCA
GTACGTAGATTCTATCGTCCCCTCAGCCTCCATCTCTATCTCTAACAACCAAGGCAGACGACCAGACCCGCATGCAGACTCAGTTCAAGGCTGTGATGCACAAGCTTGAG
CTCCTCGGACAACCAGACACTCTCGTTGACTGTTCCGATGTCATCCCTGTCCCCGCTCCCTTCAAGGGACAGGCTGTCTTCCCCGCCACGTTCAGTCGACGTGATATCCAGCAGGCT
GTA
CGCCTTCCTATTGGTCTATGTCTGATCGCTGAGCTTACTGTAGGCTTAACTAGTGCGACACGGAGCCTTTCCCCACTCTCCAGACCCTCCCCGGTCCCGAGACCTCCGTCCCTCCGGTGT
AAGTACCTTCACTGTTTGAACTTGCTTTTTGTGTTTCTAACCTGTTTATGCGTGGTAGTCCTGGGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTGCTCAGCTTTCCGCCATCGTCGCTCTCGCTCTTGGCGCAGTCCATGTCGCTCAGGCCGCTCCTCCACCGAAGGTTACCTGCGCCGACGGAAATGTCACCGCTAACGCTGTC
TGTTGCC
AGCTGTTCCCCGTCGTTGCCAATCTCCAAGAGAACCTGTTCGACGGTGCTCAGTGCGGTGAAGAGGCTCACTCTGCTCTTCGTCTGAGCTTCCACGACGCGATTGGCTGGTCG
AATTTCG
TTGATAAGGGTGATGGCGCCGACGGTTCCATCTTGGTGTTCAACGCCACTGAGTTGCAATTCCACGCCAACATTGGAATTGACGACATCACCTCCGTGCAATTCCCTGTCTTC
CAGACCACGAACTTGTCCGCTGGTGACTTCGTCCACTTGGCTGCCGCTGTCGGGACGGCCAATTGCCCCGGCGCTCCTCAGCTCGACTTCTTCTTTGGTCGTCCCCCGCCTACGGAGCCC
GCTGCTGATCTGACTGTACCCGAGCCCACGGACTCTGTTGACGCTATCATTGAGAGGTTCACCGATGCCGGCTTCGAGGTCCCTGAGATCGTGGCCCTGCTATCGTCCCACACCGTCGCT
GCTGCG
GACGAGATCGACACGACCATTCCCGGGACTCCTTTCGACACCACCCCTTTCACCTTTGACACTCAGTTCTTCGTTGAGACCTTGTTGAAGGGGTCGTTGTTCCCCGGCAATGGC
TCTCAAGCTGGTGAAGTTTTATCGCCCATCCCCGGAGAGATGCGTCTTCAGTCCGACTTTGAGCTCTCCCGTG
ACTCCCGTACTGCTTGCTTGTGGCAGGCTATGATCAACGACCAGACC
CGCATGCAGACTCAGTTCAAGGCTGTGATGCACAAGCTTGAGCTCCTCGGACAACCAGACACTCTCGTTGACTGTTCCGATGTCATCCCTGTCCCCGCTCCCTTCAAGGGACAGGCTGTC
TTCCCCGCCACGTTCAGTCGACGTGATATCCAGCAGGCT
TGCGACACGGAGCCTTTCCCCACTCTCCAGACCCTCCCCGGTCCCGAGACCTCCGTCCCTCCGGTTCCTGGGTCTTAA

Retrieve as FASTA