Entry information : SbPrx16 (Sobic.001G360500.1[2.1] / Sb01g034430[1.4])
Entry ID 851
Creation 2005-12-16 (Christophe Dunand)
Last sequence changes 2005-12-16 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-01 (Messaoudi)
Peroxidase information: SbPrx16 (Sobic.001G360500.1[2.1] / Sb01g034430[1.4])
Name (synonym) SbPrx16 (Sobic.001G360500.1[2.1] / Sb01g034430[1.4])
Class Class III peroxidase    [Orthogroup: Prx085]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx16
start..stop
S start..stop
ZmPrx02 579 0 2..328 12..335
SiPrx148 574 0 17..328 16..326
HvPrx28 558 0 4..328 10..332
TaPrx44 553 0 4..328 10..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 57887603..57887812 210 N° 2 57886666..57887442 777  
complement(join(57886666..57887442,57887603..57887812))


exon

Literature and cross-references SbPrx16 (Sobic.001G360500.1[2.1] / Sb01g034430[1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_1 (57887812..57886666)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.952.1
Protein sequence: SbPrx16 (Sobic.001G360500.1[2.1] / Sb01g034430[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (309)
PWM (Da):   %s   34917.46 (33062.4)  
PI (pH):   %s   5.71 (5.71) Peptide Signal:   %s   cut: 20 range:20-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSVLAALSLLLLAVACQASPYYPLELGYYRYKCPQAEAIVKAIMEKAIAQNPGNGAGLIRMLFHDCFVEGCDASVLLDPTPFSPTPEKTSPPNNPSLRGFELIDAIKDALEAACPGVVSCADIIAFAARDASYFLSGGKVRFDMPAGRLDGTFSNASESLKFLVPPTSNLSTLVSSFAVKGMSVEDLVVLSGAHTVGRSHCSSFVSDRLNASVPSDISPGLAGFLKSRCPANPTSSGNDPTVMQDVVTPNAMDNQYYKNVLSHTVLFTSDADLLTSAQTAKLVLDNANIPGWWEDKFEKAMVKMASIEVKTGYQGQVRKNCRAINHY*

Retrieve as FASTA  
Remarks Complete sequence from Genomic DNA (intron 1) and 40 ESTs. Strongly expressed.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCGTTTTAGCCGCACTTAGCTTGCTGCTCCTAGCCGTTGCGTGCCAGGCCAGCCCTTACTACCCTCTGGAGCTAGGGTACTACCGTTACAAGTGTCCCCAGGCTGAGGCCATC
GTGAAGGCCATCATGGAGAAGGCCATCGCCCAGAACCCTGGCAATGGCGCTGGTCTCATCCGTATGCTCTTCCATGACTGTTTCGTCGAG
GTACTTTACTTTATATATATATCATCTAAG
AATGGATTTATTACATTGCAACATACATCGTCCTTATTACAAAACTATAGGAGTATAAAGTAGTAGCTATAGACCCCTCTCACTGTTACTGCCTAATTAATTATTTCACTGTTGAGTGTT
GACTATCTAGGGCTGTGATGCTTCCGTGCTTCTGGACCCGACCCCGTTCAGCCCGACGCCGGAGAAGACAAGCCCGCCCAACAACCCAAGCCTACGCGGGTTCGAGCTGATCGACGCCAT
CAAGGACGCCCTGGAGGCCGCGTGCCCCGGGGTCGTCTCCTGCGCCGACATCATCGCCTTCGCGGCCCGCGACGCGTCCTACTTCCTGAGCGGCGGCAAGGTCCGCTTCGACATGCCGGC
GGGCCGCCTGGACGGCACCTTCTCCAACGCCTCCGAGTCGCTCAAGTTCCTGGTCCCGCCGACGTCCAACCTCAGCACCCTCGTCTCCAGCTTCGCCGTCAAGGGGATGTCGGTGGAGGA
CCTGGTCGTGCTCTCCGGCGCGCACACCGTCGGCCGCTCCCACTGCTCCTCCTTCGTCTCCGACCGCCTCAATGCCTCGGTCCCCTCCGACATCAGCCCCGGGCTAGCCGGCTTCCTCAA
GAGCCGCTGCCCGGCCAACCCGACGAGCAGCGGCAACGACCCCACGGTGATGCAGGACGTGGTGACGCCCAACGCCATGGACAACCAGTACTACAAGAACGTGCTGTCGCACACCGTGCT
CTTCACCTCCGACGCCGATCTCCTCACGTCGGCGCAGACGGCCAAGCTGGTGCTGGACAACGCCAATATCCCCGGGTGGTGGGAGGACAAGTTCGAGAAGGCCATGGTGAAGATGGCCAG
CATCGAAGTCAAGACCGGCTACCAAGGCCAGGTGAGGAAGAACTGCAGGGCGATCAATCACTACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCCGTTTTAGCCGCACTTAGCTTGCTGCTCCTAGCCGTTGCGTGCCAGGCCAGCCCTTACTACCCTCTGGAGCTAGGGTACTACCGTTACAAGTGTCCCCAGGCTGAGGCCATC
GTGAAGGCCATCATGGAGAAGGCCATCGCCCAGAACCCTGGCAATGGCGCTGGTCTCATCCGTATGCTCTTCCATGACTGTTTCGTCGAG
GGCTGTGATGCTTCCGTGCTTCTGGACCCG
ACCCCGTTCAGCCCGACGCCGGAGAAGACAAGCCCGCCCAACAACCCAAGCCTACGCGGGTTCGAGCTGATCGACGCCATCAAGGACGCCCTGGAGGCCGCGTGCCCCGGGGTCGTCTCC
TGCGCCGACATCATCGCCTTCGCGGCCCGCGACGCGTCCTACTTCCTGAGCGGCGGCAAGGTCCGCTTCGACATGCCGGCGGGCCGCCTGGACGGCACCTTCTCCAACGCCTCCGAGTCG
CTCAAGTTCCTGGTCCCGCCGACGTCCAACCTCAGCACCCTCGTCTCCAGCTTCGCCGTCAAGGGGATGTCGGTGGAGGACCTGGTCGTGCTCTCCGGCGCGCACACCGTCGGCCGCTCC
CACTGCTCCTCCTTCGTCTCCGACCGCCTCAATGCCTCGGTCCCCTCCGACATCAGCCCCGGGCTAGCCGGCTTCCTCAAGAGCCGCTGCCCGGCCAACCCGACGAGCAGCGGCAACGAC
CCCACGGTGATGCAGGACGTGGTGACGCCCAACGCCATGGACAACCAGTACTACAAGAACGTGCTGTCGCACACCGTGCTCTTCACCTCCGACGCCGATCTCCTCACGTCGGCGCAGACG
GCCAAGCTGGTGCTGGACAACGCCAATATCCCCGGGTGGTGGGAGGACAAGTTCGAGAAGGCCATGGTGAAGATGGCCAGCATCGAAGTCAAGACCGGCTACCAAGGCCAGGTGAGGAAG
AACTGCAGGGCGATCAATCACTACTAG

Retrieve as FASTA