Entry information : DsCIIBA05 ( MnP8)
Entry ID 8511
Creation 2011-09-21 (Christophe Dunand)
Last sequence changes 2011-09-21 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-17 (Catherine Mathe)
Peroxidase information: DsCIIBA05 ( MnP8)
Name (synonym) DsCIIBA05 ( MnP8)
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus
Organism Dichomitus squalens    [TaxId: 114155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsCIIBA05
start..stop
S start..stop
GsppCIIBA06 576 0 14..364 15..358
ParcCIIBA01 570 0 1..364 1..361
TvCIIBA11 514 0 1..364 1..362
ParcCIIBA02 502 5e-180 20..364 20..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 80176..80283 108 N° 2 80075..80118 44 N° 3 79978..80023 46 N° 4 79850..79920 71
N° 5 79675..79806 132 N° 6 79379..79610 232 N° 7 79265..79327 63 N° 8 79063..79207 145
N° 9 78788..79003 216 N° 10 78690..78727 38  
complement(join(78690..78727,78788..79003,79063..79207,79265..79327,79379..79610 ,79675..79806,79850..79920,79978..80023,80075..80118,80176..80283))


exon

Literature and cross-references DsCIIBA05 ( MnP8)
DNA ref. JGI genome:   scaffold_24 (80283..78690)
Cluster/Prediction ref. JGI gene:   13461
Protein sequence: DsCIIBA05 ( MnP8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (346)
PWM (Da):   %s   38674.38 (36719.2)  
PI (pH):   %s   5.36 (5.06) Peptide Signal:   %s   cut: 19 range:19-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFAKALIPFLSLALIVRAAPSHKSDCGNGHLASNSQCCVWYDVLDDIQTNLFDGGECGEEAHESLSTFHDAIGFSPALFREGKFGQVLHGGGADGSIMAFPIETTFKASAGLDEIVGEQKPFALKHNVSFGDFIQFAGAVGVSNCRGGPRLQFLAGRSNHSQVSPDGLIPLPEDPVDKILARMADAGFSPAEVVDLLASHTVAAQDHVDTIHGSPFDSTPSDFDAQFFVETLLKGVAFPGNGSNVGEVLSPYPGEMRLQSDAAIARDPRTACEWQSFIANQELMVRKFEKVMAKMAVLGQDPRKLSDCSEVIPVPKPAASQVAHLPAGKKLKDIQVSCKHIPFPTIKADPGPETSIPVVPAS

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTGCTAAAGCTCTGATCCCATTTCTTTCCCTCGCCTTGATTGTCCGAGCTGCTCCCTCGCACAAGTCAGACTGTGGCAACGGCCACCTGGCGAGTAACTCTCAGGTAAGGCGTATC
CACAAATGTTTCTGTTCAGCCCTGTTTACTCGCCAATCTCCTTAGTGCTGTGTGTGGTATGATGTCCTCGACGACATCCAGACGAACCTGTGAGAATGGCGCGCTTCGGAGGTCTGTCGG
CCCTGCTGAACATAGTCTAGCTTCGATGGCGGCGAGTGCGGGGAAGAGGCCCATGAGTCTCTCCGGGTGAGCATTTCTTCGTCTCCGGTACTGATCTCAAGGACTAATGGCAATACTTTA
TAGTCAACCTTCCACGATGCCATTGGCTTCTCTCCTGCGCTCTTCAGAGAGGGGAAGTTTGGGCAAGTCCTTCAGTCCTGTACTGCATGATTGTGGTACTAACCGCCTCTCTCACAGCGG
TGGCGGTGCCGACGGTTCCATCATGGCCTTTCCCATCGAGACCACCTTTAAAGCTAGCGCCGGCCTAGACGAGATCGTTGGAGAGCAGAAGCCCTTTGCTCTCAAACATAACGTCTCATT
TGGTGATTT
GTGCGTCTCCCACTCCCACATAACATGTTCTATACTTGTTCCCGCTCACGTCTATCACCTATAGCATTCAATTCGCCGGTGCGGTTGGTGTCAGCAATTGCCGTGGTGGCC
CTCGCCTGCAGTTCCTTGCAGGCCGGTCCAATCACTCTCAAGTTTCACCAGACGGCCTGATTCCGCTCCCGGAGGACCCCGTGGACAAGATCCTCGCCCGCATGGCAGACGCTGGGTTTA
GTCCTGCTGAGGTCGTCGACTTGCTTGCGTCACACACGGTAGCTGCTCAGGACCACGTCGACCCG
GTGAGCATATGCGCACGGTTCACACAAGATAATCGCTGACGATGCGCATAGACTA
TTCATGGCAGCCCCTTCGACTCTACTCCCTCCGACTTCGATGCTCAGTTCTTCGTCGAG
GTGCGAACGCCGGTGTCTGTGTTCAGGACGATAGAGCTGACGCTGAATTATCTCTAGACAC
TTCTCAAGGGTGTAGCCTTCCCTGGTAACGGCTCGAACGTCGGTGAGGTCCTCTCCCCATATCCGGGTGAGATGCGTCTTCAGTCCGATGCTGCCATCGCCCGTGATCCCCGCACGGCCT
GCGAGTGGCAGTCGTTCATCG
GTGAGCATGCTGTAGTCATCTGGCTGCGTGCAAGGAGCGCTCAACATTCCCCGTCACAGCAAACCAAGAACTGATGGTCAGGAAATTTGAGAAGGTCAT
GGCCAAGATGGCGGTGCTCGGGCAGGACCCTCGCAAACTTAGTGACTGCTCTGAGGTCATCCCCGTGCCCAAGCCCGCCGCATCTCAAGTCGCGCATCTCCCCGCTGGCAAGAAACTCAA
GGATATCCAGGTGTCATGCAAACATATTCCGTTCCCCACCATCAAGGCTGACCCTG
GTGAGCTCTCCCTCTCGGCGTGGGGGCTGATAAAGGCGTGCTGACAGGAGGATTTGGTAGGCCC
GGAGACCTCCATCCCCGTTGTCCCTGCTTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTGCTAAAGCTCTGATCCCATTTCTTTCCCTCGCCTTGATTGTCCGAGCTGCTCCCTCGCACAAGTCAGACTGTGGCAACGGCCACCTGGCGAGTAACTCTCAGTGCTGTGTGTGG
TATGATGTCCTCGACGACATCCAGACGAACCT
CTTCGATGGCGGCGAGTGCGGGGAAGAGGCCCATGAGTCTCTCCGGTCAACCTTCCACGATGCCATTGGCTTCTCTCCTGCGCTCTTC
AGAGAGGGGAAGTTTGGGCAAGTCCTTCA
CGGTGGCGGTGCCGACGGTTCCATCATGGCCTTTCCCATCGAGACCACCTTTAAAGCTAGCGCCGGCCTAGACGAGATCGTTGGAGAGCAG
AAGCCCTTTGCTCTCAAACATAACGTCTCATTTGGTGATTT
CATTCAATTCGCCGGTGCGGTTGGTGTCAGCAATTGCCGTGGTGGCCCTCGCCTGCAGTTCCTTGCAGGCCGGTCCAAT
CACTCTCAAGTTTCACCAGACGGCCTGATTCCGCTCCCGGAGGACCCCGTGGACAAGATCCTCGCCCGCATGGCAGACGCTGGGTTTAGTCCTGCTGAGGTCGTCGACTTGCTTGCGTCA
CACACGGTAGCTGCTCAGGACCACGTCGACCCG
ACTATTCATGGCAGCCCCTTCGACTCTACTCCCTCCGACTTCGATGCTCAGTTCTTCGTCGAGACACTTCTCAAGGGTGTAGCCTTC
CCTGGTAACGGCTCGAACGTCGGTGAGGTCCTCTCCCCATATCCGGGTGAGATGCGTCTTCAGTCCGATGCTGCCATCGCCCGTGATCCCCGCACGGCCTGCGAGTGGCAGTCGTTCATC
G
CAAACCAAGAACTGATGGTCAGGAAATTTGAGAAGGTCATGGCCAAGATGGCGGTGCTCGGGCAGGACCCTCGCAAACTTAGTGACTGCTCTGAGGTCATCCCCGTGCCCAAGCCCGCC
GCATCTCAAGTCGCGCATCTCCCCGCTGGCAAGAAACTCAAGGATATCCAGGTGTCATGCAAACATATTCCGTTCCCCACCATCAAGGCTGACCCTG
GCCCGGAGACCTCCATCCCCGTT
GTCCCTGCTTCGTAA

Retrieve as FASTA