Entry information : DsCIIBA06 ( MnP9)
Entry ID 8512
Creation 2011-09-21 (Christophe Dunand)
Last sequence changes 2016-02-15 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-16 (Christophe Dunand)
Peroxidase information: DsCIIBA06 ( MnP9)
Name (synonym) DsCIIBA06 ( MnP9)
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus
Organism Dichomitus squalens    [TaxId: 114155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsCIIBA06
start..stop
S start..stop
TvCIIBA 496 1e-177 1..356 1..359
GsppCIIBA06 484 6e-173 18..357 19..356
ParcCIIBA02 466 1e-165 24..357 22..361
DsCIIBA05 459 5e-163 1..358 1..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47072..47185 114 N° 2 47236..47305 70 N° 3 47360..47385 26 N° 4 47438..47478 41
N° 5 47542..47555 14 N° 6 47608..47728 121 N° 7 47785..48079 295 N° 8 48133..48277 145
N° 9 58393..58633 241 N° 10 58702..58711 10  
join(47072..47185,47236..47305,47360..47385,47438..47478,47542..47555,47608..477 28,47785..48079,48133..48277,58393..58633,58702..58711)


exon

Literature and cross-references DsCIIBA06 ( MnP9)
DNA ref. JGI genome:   scaffold_74 (47072..58712)
Protein sequence: DsCIIBA06 ( MnP9)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (340)
PWM (Da):   %s   37444.41 (35517.3)  
PI (pH):   %s   4.15 (4.12) Peptide Signal:   %s   cut: 19 range:19-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLFKAVLLVVSLALAVTAVPPHVKRAACSNGRSANDARCCVWFDVLDDIQADEGLFEGGQCVEEAHESLRLTFHDAIAFSPTQGGGGADGSIIAHSDEELKDPANNGVDEIIEKLRPLAIKHNVSFGDFIQFAGAVGVSNCMGGPRLQFLAGRSNDSTAAPAGLVPKPEDPIDQILDRMADAGFSANELVDLLASHSVAAQDTIDPTIQGHPFDSTPSTFDSQFFVETLLKGTSFPGNGSNVGEAESPYPGEFRLLSDQVIARDSRTACEWQSLSPDHDAMVSKFTAAMAKMAVLGQDVNSLVDCSEVIPTPATLATKVAVIPAGLSLDDIEASCSETPFPTISVAPGAETSVAAVPS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns). Atypical very large introns 7 (10000 nt) due to "N3 in the sequence.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTTCAAGGCTGTTCTCTTAGTTGTCTCTCTTGCTCTCGCTGTCACCGCAGTTCCGCCTCACGTGAAGCGTGCTGCGTGCAGCAACGGCCGTTCTGCCAATGACGCAAGGGTATGT
GACATTATGAACAAACTCTTCCCTACTTCTGACAAGTCCTGCAGTGCTGTGTCTGGTTTGACGTTCTCGACGACATCCAGGCCGACGAAGGTCTCTTTGAGGGAGGCCAGTGTGGTGGGC
ATAATCCTTCACACTTGTCTTGATGCCGAGTCTAAATATATGTCATAGTTGAGGAGGCTCACGAGTCCCTTCGTGTAAGTAAGCCTTTGGTCATCTTGTATGACCACCAACTCACTTGCT
TTGCAGTTGACTTTCCATGATGCTATTGCCTTCTCTCCAACTCAGGGGTATGTCTCAGAACTTACAATCCTGTTTGTGCCGTATTTACTGATAGTGATTGTTGGCCACAGTGGCGGAGGA
GCTG
GTAAGTCCTAACCTTCTTCGATTAGGCGGTTCGCTTACAGTGCCTGTCACAGATGGCTCGATCATCGCTCACTCTGATGAAGAGCTCAAGGACCCGGCCAACAACGGTGTCGACGA
GATCATCGAGAAGCTTCGCCCCTTGGCCATCAAGCACAACGTCTCCTTTGGCGATTT
GTACGTCATATACTTAAAGACCGAAATCAGTCTACTGAGAACTCTACTGCTTGTAGTATCCAG
TTCGCCGGTGCTGTCGGCGTGAGCAACTGTATGGGTGGTCCCCGCCTGCAGTTCCTCGCGGGACGCTCCAACGACTCTACGGCAGCTCCCGCCGGGCTCGTCCCCAAGCCTGAGGACCCG
ATCGACCAGATCCTCGACCGCATGGCCGATGCAGGGTTCTCCGCAAACGAGCTGGTCGACCTTCTCGCCTCGCACTCCGTGGCTGCGCAGGACACTATCGACCCCACGATCCAGGGGCAC
CCCTTCGACTCGACTCCGTCGACCTTTGACTCGCAGTTCTTCGTAGAG
GTAGGTACTTCGGAGTTCGGTTCTTCGGCCGTGCTGACAATTGCTGGTTGCAGACCCTGCTGAAAGGCACGA
GCTTCCCTGGTAACGGCTCCAACGTCGGCGAGGCCGAGTCGCCCTACCCAGGCGAGTTCCGCCTCCTCTCCGACCAGGTTATCGCTCGCGACTCGCGTACGGCCTGCGAATGGCAGTCGT
TGTCGC
GCGACTAGGCGCGTAGACTCGGGTCGACGTTCGGCGACGACCCCGTAGGCGAGCGGCGAGGAGCCGAAAGGGGGAAAGCGAGGGAAAGAGGGATAAACGCAACAAGAAACTCGA
CGGGGCAGAGCGGAGGCCGGCACGAAGGCACAAGACCTACGAAGCTAGTCTTCACGCAGATAGCGACAGACTAGTCCCAATGACCAAGTTATACATTAGCAATCGAAGAGAGATACAACA
CTATGGTCACTCACCTAGTCCCAATGACCAAGAGGTCGAGATGGGGACTAGGGAGCGCCTAGGGGGGTCCTTATATACTAGAGGGGCTGCTTAGCAACCAAGGACAAGGCGCGAGAGCGA
GGCAGTGAAGATGACAAAGGGGGAACAAAGGGCGAGAAAGAAAAGGCAAGGGCATGGCGATCACGGGAACGTAGCATGCGGCTGTGGGAACGTATCTACAGTGTCCAAACTGGGATGAGC
TAGGAAAGGAAACGGTCCGGAAATGGAAGGTGGGCGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGCCGGCACGAAGGCACAAGACCTACGA
AGCTAGTCTTCACGCAGATAGCGACAGACTAGTCCCAATGACCAAGTTATACATTAGCAATCGAAGAGAGATACAACACTATGGTCACTCACCTAGTCCCAATGACCAAGAGGTCGAGAT
GGGGACTAGGGAGCGCCTAGGGGGGTCCTTATATACTAGAGGGGCTGCTTAGCAACCAAGGACAAGGCGCGAGAGCGAGGCAGTGAAGATGACAAAGGGGGAACAAAGGGCGAGAAAGAA
AAGGCAAGGGCATGGCGATCACGGGAACGTAGCATGCGGCTGTGGGAACGTATCTACAGTGTCCAAACTGGGATGAGCTAGGAAAGGAAACGGTCCGGAAATGGAAGGTGGGCGTCAAAG
GGAAGGGAATGGGCGGCAAAAAGGGGCGTCTGTCCAACGTCCGTGACAGTTGTTCATCAGTACGTATTTACCCCCTCCTGTTTATCTCATATATCTCAGCGTCGACTGCCCCCTTACTTC
TACGAATCGCCAACTTACTCGTGGCTGACCGACCCAAACAGCCGATCACGACGCGATGGTCAGCAAGTTCACCGCAGCGATGGCGAAGATGGCCGTGCTCGGCCAGGACGTGAACTCGCT
CGTCGACTGTTCTGAGGTCATCCCGACGCCCGCTACGCTCGCCACGAAGGTCGCGGTCATCCCGGCGGGTTTGTCGTTGGACGACATCGAGGCGTCCTGCTCCGAGACGCCCTTCCCCAC
CATTTCAGTCGCCCCAGGTGCGGAGACATCCGTTGCTGCTGT
GTAAGTTCTCTTGTGTCTATGTGTGCAATCTGTGATCGCTAGACTCACGTTGACGCTTGCCGTGACAGCCCCTCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTTCAAGGCTGTTCTCTTAGTTGTCTCTCTTGCTCTCGCTGTCACCGCAGTTCCGCCTCACGTGAAGCGTGCTGCGTGCAGCAACGGCCGTTCTGCCAATGACGCAAGGTGCTGT
GTCTGGTTTGACGTTCTCGACGACATCCAGGCCGACGAAGGTCTCTTTGAGGGAGGCCAGTGTG
TTGAGGAGGCTCACGAGTCCCTTCGTTTGACTTTCCATGATGCTATTGCCTTCTCT
CCAACTCAGGG
TGGCGGAGGAGCTGATGGCTCGATCATCGCTCACTCTGATGAAGAGCTCAAGGACCCGGCCAACAACGGTGTCGACGAGATCATCGAGAAGCTTCGCCCCTTGGCCATC
AAGCACAACGTCTCCTTTGGCGATTT
TATCCAGTTCGCCGGTGCTGTCGGCGTGAGCAACTGTATGGGTGGTCCCCGCCTGCAGTTCCTCGCGGGACGCTCCAACGACTCTACGGCAGCT
CCCGCCGGGCTCGTCCCCAAGCCTGAGGACCCGATCGACCAGATCCTCGACCGCATGGCCGATGCAGGGTTCTCCGCAAACGAGCTGGTCGACCTTCTCGCCTCGCACTCCGTGGCTGCG
CAGGACACTATCGACCCCACGATCCAGGGGCACCCCTTCGACTCGACTCCGTCGACCTTTGACTCGCAGTTCTTCGTAGAG
ACCCTGCTGAAAGGCACGAGCTTCCCTGGTAACGGCTCC
AACGTCGGCGAGGCCGAGTCGCCCTACCCAGGCGAGTTCCGCCTCCTCTCCGACCAGGTTATCGCTCGCGACTCGCGTACGGCCTGCGAATGGCAGTCGTTGTCGC
CCGATCACGACGCG
ATGGTCAGCAAGTTCACCGCAGCGATGGCGAAGATGGCCGTGCTCGGCCAGGACGTGAACTCGCTCGTCGACTGTTCTGAGGTCATCCCGACGCCCGCTACGCTCGCCACGAAGGTCGCG
GTCATCCCGGCGGGTTTGTCGTTGGACGACATCGAGGCGTCCTGCTCCGAGACGCCCTTCCCCACCATTTCAGTCGCCCCAGGTGCGGAGACATCCGTTGCTGCTGT
CCCCTCGTAG

Retrieve as FASTA