Entry information : PstrCIIBB02 (MnP4-short)
Entry ID 8515
Creation 2011-09-22 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2017-03-10 (Catherine Mathe)
Peroxidase information: PstrCIIBB02 (MnP4-short)
Name (synonym) PstrCIIBB02 (MnP4-short)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrCIIBB02
start..stop
S start..stop
HanCIIBB02 584 0 1..359 1..356
PstrCIIBB01 578 0 1..348 1..347
TvCIIBB02_IFO30340 563 0 1..359 1..365
TvCIIBB02 563 0 1..359 1..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 365007..365254 248 N° 2 365306..365373 68 N° 3 365424..366187 764  
join(365007..365254,365306..365373,365424..366187)


exon

Literature and cross-references PstrCIIBB02 (MnP4-short)
DNA ref. JGI genome:   scaffold_5 (365007..366187)
Cluster/Prediction ref. JGI gene:   3296
Protein sequence: PstrCIIBB02 (MnP4-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (339)
PWM (Da):   %s   37482.34 (35470.2)  
PI (pH):   %s   4.18 (4.18) Peptide Signal:   %s   cut: 21 range:21-359
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFQLLSALAVVVASQVVNAAITRRVACPDGVNSATNAACCALFAIRDDIQENLFDGGECGEEVHESLRLTFHDAIGISRSKDVGGGADGSMIIFSDIETAFHAGGIDDIVDAQSPFIAKHNITAGDFIQFAGAIGVSNCSGAPRLDFFLGRPEATKPAADMTVPEPFDTVDSILARFADAGAFTPAEVVALLASHTIAAADHVDPSIPGTPFDSTPSVFDTQFFIETQLRGTLFPGTGGNQGEVESPLHGEIRLQSDSELARDSRTACEWQSMVNNQAKMQAAFKAAMLKLSVLGHNIEDMVDCSELIPEPPTLTKAATFPAGFSHADVEQACATTPFPTLSSDPGPVTSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCCAGCTCCTTTCTGCTCTTGCTGTCGTCGTTGCCTCGCAGGTGGTCAACGCCGCTATCACCCGCCGCGTTGCCTGCCCCGACGGCGTGAACTCTGCGACTAACGCAGCTTGC
TGCGCATTGTTTGCCATCCGCGACGACATCCAGGAGAACCTCTTCGATGGTGGCGAGTGCGGCGAGGAGGTTCACGAGTCTCTCCGTCTTACCTTCCACGATGCCATTGGTATCTCTCGG
TCCAAGGA
GTAAGACTTCACTGCTCAGTAACTTGATCGTGCTTATCATATTTCTAACAGCGTTGGCGGAGGTGCCGACGGGTCTATGATCATCTTCTCAGATATCGAGACTGCCTTCCAT
GCGAATG
GTTCGTCGCTCTATCCTGGTGATCGATCATTGAATTGACATTCCTTGCAGGTGGTATCGACGACATTGTCGACGCTCAGTCGCCCTTCATCGCCAAGCACAACATCACGGCCG
GCGACTTCATCCAGTTCGCTGGGGCCATCGGCGTCTCCAACTGTTCCGGGGCTCCGCGCCTGGACTTCTTCCTCGGTCGCCCGGAGGCCACAAAGCCCGCCGCCGACATGACGGTCCCGG
AGCCCTTCGACACTGTGGACTCCATCCTCGCCCGCTTCGCCGATGCCGGTGCCTTCACTCCTGCCGAGGTCGTCGCCCTTCTTGCGTCGCACACCATCGCCGCCGCAGACCACGTCGACC
CCAGCATCCCCGGCACGCCATTCGATTCTACTCCTAGCGTGTTCGACACCCAGTTCTTCATTGAAACCCAGCTCCGCGGCACGCTATTTCCCGGCACCGGCGGAAACCAAGGCGAGGTCG
AGTCACCCCTACACGGCGAGATCCGTCTCCAATCCGACTCGGAGCTCGCCCGCGACTCGCGCACGGCGTGCGAGTGGCAGAGCATGGTGAACAACCAGGCGAAGATGCAGGCGGCTTTCA
AGGCGGCGATGCTCAAGCTGTCCGTGCTTGGCCACAACATCGAGGACATGGTGGACTGCTCCGAGCTCATCCCCGAACCACCGACGCTCACGAAGGCTGCCACCTTCCCGGCTGGATTCA
GCCACGCCGACGTTGAGCAGGCCTGTGCGACGACGCCGTTCCCTACCCTCTCCTCCGACCCTGGCCCAGTCACTTCCGTAGCCCCGGTTCCCCCTTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCCAGCTCCTTTCTGCTCTTGCTGTCGTCGTTGCCTCGCAGGTGGTCAACGCCGCTATCACCCGCCGCGTTGCCTGCCCCGACGGCGTGAACTCTGCGACTAACGCAGCTTGC
TGCGCATTGTTTGCCATCCGCGACGACATCCAGGAGAACCTCTTCGATGGTGGCGAGTGCGGCGAGGAGGTTCACGAGTCTCTCCGTCTTACCTTCCACGATGCCATTGGTATCTCTCGG
TCCAAGGA
CGTTGGCGGAGGTGCCGACGGGTCTATGATCATCTTCTCAGATATCGAGACTGCCTTCCATGCGAATGGTGGTATCGACGACATTGTCGACGCTCAGTCGCCCTTCATCGCC
AAGCACAACATCACGGCCGGCGACTTCATCCAGTTCGCTGGGGCCATCGGCGTCTCCAACTGTTCCGGGGCTCCGCGCCTGGACTTCTTCCTCGGTCGCCCGGAGGCCACAAAGCCCGCC
GCCGACATGACGGTCCCGGAGCCCTTCGACACTGTGGACTCCATCCTCGCCCGCTTCGCCGATGCCGGTGCCTTCACTCCTGCCGAGGTCGTCGCCCTTCTTGCGTCGCACACCATCGCC
GCCGCAGACCACGTCGACCCCAGCATCCCCGGCACGCCATTCGATTCTACTCCTAGCGTGTTCGACACCCAGTTCTTCATTGAAACCCAGCTCCGCGGCACGCTATTTCCCGGCACCGGC
GGAAACCAAGGCGAGGTCGAGTCACCCCTACACGGCGAGATCCGTCTCCAATCCGACTCGGAGCTCGCCCGCGACTCGCGCACGGCGTGCGAGTGGCAGAGCATGGTGAACAACCAGGCG
AAGATGCAGGCGGCTTTCAAGGCGGCGATGCTCAAGCTGTCCGTGCTTGGCCACAACATCGAGGACATGGTGGACTGCTCCGAGCTCATCCCCGAACCACCGACGCTCACGAAGGCTGCC
ACCTTCCCGGCTGGATTCAGCCACGCCGACGTTGAGCAGGCCTGTGCGACGACGCCGTTCCCTACCCTCTCCTCCGACCCTGGCCCAGTCACTTCCGTAGCCCCGGTTCCCCCTTCCTAA

Retrieve as FASTA