Entry information : PstrCIIBB01 (MnP3-short)
Entry ID 8516
Creation 2011-09-22 (Christophe Dunand)
Last sequence changes 2012-04-03 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2017-03-10 (Catherine Mathe)
Peroxidase information: PstrCIIBB01 (MnP3-short)
Name (synonym) PstrCIIBB01 (MnP3-short)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrCIIBB01
start..stop
S start..stop
PstrCIIBB02 599 0 1..358 1..359
HanCIIBB02 522 0 9..358 10..356
TvCIIBB02 516 0 1..358 1..365
BaCIIBB08 516 0 1..358 1..366
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 357079..357267 189 N° 2 356970..357026 57 N° 3 356842..356905 64 N° 4 356099..356787 689
N° 5 355973..356047 75  
complement(join(355973..356047,356099..356787,356842..356905,356970..357026,3570 79..357267))


exon

Literature and cross-references PstrCIIBB01 (MnP3-short)
DNA ref. JGI genome:   scaffold_5 (357267..355973)
Protein sequence: PstrCIIBB01 (MnP3-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (337)
PWM (Da):   %s   37038.16 (35039.0)  
PI (pH):   %s   4.17 (4.09) Peptide Signal:   %s   cut: 21 range:21-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVKALLPLALLAVSQTAHAAITRRVACPDGVNTATNAACCAFFAIRDDIQENLFDGGECGEEVHESLRLTFHDAIGISQSNGGADGSMITFADTETAF*YANGGIDEIVDAQTPFIAKHNITAGDFIQFAGAVGVSNCPGAPQLDFFLGRPGAVHPAVDKTVPEPFDTVDSILGRSADAGDFTPAEVVALLASHTIAAADLVDPSIPGTPFDSTPGMFDSQFFVETQLRGTLFPGTGGNQGEVESPLRGEIRLQSDSELARDSRTACEWQSMVNNEAKMQAAFKGAMLKLSVLGHNIEDMIDCSEVIPVPKALPPKAATFPAGLSHADVEQCAPAAFPTLASDPGPAMAVPPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns, one stop codon in frame). Uncorrect prediction from Phytozome, due to stop in frame => short exon SNAD :CGCGGACG and missing sequence)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCAAGGCACTCCTTCCTCTTGCACTCCTCGCGGTTTCGCAGACTGCGCATGCTGCAATCACCCGTCGCGTCGCATGTCCTGACGGCGTGAACACTGCAACAAACGCAGCATGC
TGCGCGTTTTTTGCTATTAGGGATGACATTCAGGAGAACCTCTTTGACGGCGGCGAGTGCGGGGAGGAG
GTAGGTCTCTCTGTGTGATAGAGTAGCCAAATATTCAATACTCTTTCGTCA
GGTCCACGAGTCGCTTCGTTTGACCTTCCACGATGCTATAGGTATCTCGCAATCCAATTCAAAGTAAGTGTTCTGTTTATGCCATGGACTGGAGACTGACTGAACCGGTTGTCAGCGCGG
ACGGTGGCGCAGATGGGTCGATGATCACGTTCGCGGATACCGAAACGGCTTTCTAGTATGCTAACGGTACGATTATATTCACCCTTCCAAACCTACGCTAACTTTTCTCGTACGTTTCAG

GCGGTATCGACGAGATTGTCGATGCACAGACTCCGTTCATAGCTAAACACAACATCACCGCTGGCGATTTTATCCAATTCGCCGGTGCTGTCGGCGTGTCCAATTGCCCAGGCGCGCCTC
AACTCGACTTCTTCCTCGGCCGTCCAGGGGCCGTTCACCCGGCGGTGGACAAGACCGTTCCAGAGCCCTTCGACACAGTGGACTCCATCCTTGGCCGCTCTGCCGACGCTGGCGACTTCA
CACCGGCTGAAGTCGTCGCGCTCTTAGCTTCACACACCATTGCAGCGGCAGATCTCGTCGATCCCAGCATCCCTGGTACACCCTTCGATTCCACTCCCGGCATGTTCGACAGCCAGTTCT
TTGTCGAAACGCAGCTTCGTGGCACACTATTCCCTGGTACCGGCGGGAACCAAGGCGAGGTTGAATCCCCTCTGCGCGGCGAGATCCGTCTCCAATCAGACTCAGAGCTCGCTCGCGATT
CCCGCACGGCCTGCGAGTGGCAGAGCATGGTGAACAACGAAGCGAAGATGCAGGCAGCGTTCAAGGGGGCGATGCTCAAGCTATCAGTCCTCGGTCACAACATCGAGGATATGATTGATT
GCTCAGAGGTCATCCCGGTTCCCAAGGCGCTACCGCCCAAGGCTGCAACATTCCCCGCTGGCCTGAGCCACGCCGATGTCGAGCAGGCG
GTGAGCACATTTCTTAGCTGTTGTTGGAGTT
AGCCTCACCTCGCTTCACAGTGCGCACCTGCTGCTTTCCCGACTCTGGCTTCCGACCCTGGACCAGCAATGGCAGTCCCTCCAGTTCCGCCTTCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCAAGGCACTCCTTCCTCTTGCACTCCTCGCGGTTTCGCAGACTGCGCATGCTGCAATCACCCGTCGCGTCGCATGTCCTGACGGCGTGAACACTGCAACAAACGCAGCATGC
TGCGCGTTTTTTGCTATTAGGGATGACATTCAGGAGAACCTCTTTGACGGCGGCGAGTGCGGGGAGGAG
GTCCACGAGTCGCTTCGTTTGACCTTCCACGATGCTATAGGTATCTCGCAA
TCCAAT
GGTGGCGCAGATGGGTCGATGATCACGTTCGCGGATACCGAAACGGCTTTCTAGTATGCTAACGGCGGTATCGACGAGATTGTCGATGCACAGACTCCGTTCATAGCTAAACAC
AACATCACCGCTGGCGATTTTATCCAATTCGCCGGTGCTGTCGGCGTGTCCAATTGCCCAGGCGCGCCTCAACTCGACTTCTTCCTCGGCCGTCCAGGGGCCGTTCACCCGGCGGTGGAC
AAGACCGTTCCAGAGCCCTTCGACACAGTGGACTCCATCCTTGGCCGCTCTGCCGACGCTGGCGACTTCACACCGGCTGAAGTCGTCGCGCTCTTAGCTTCACACACCATTGCAGCGGCA
GATCTCGTCGATCCCAGCATCCCTGGTACACCCTTCGATTCCACTCCCGGCATGTTCGACAGCCAGTTCTTTGTCGAAACGCAGCTTCGTGGCACACTATTCCCTGGTACCGGCGGGAAC
CAAGGCGAGGTTGAATCCCCTCTGCGCGGCGAGATCCGTCTCCAATCAGACTCAGAGCTCGCTCGCGATTCCCGCACGGCCTGCGAGTGGCAGAGCATGGTGAACAACGAAGCGAAGATG
CAGGCAGCGTTCAAGGGGGCGATGCTCAAGCTATCAGTCCTCGGTCACAACATCGAGGATATGATTGATTGCTCAGAGGTCATCCCGGTTCCCAAGGCGCTACCGCCCAAGGCTGCAACA
TTCCCCGCTGGCCTGAGCCACGCCGATGTCGAGCAGGCG
TGCGCACCTGCTGCTTTCCCGACTCTGGCTTCCGACCCTGGACCAGCAATGGCAGTCCCTCCAGTTCCGCCTTCG

Retrieve as FASTA