Entry information : SbPrx63 (Sobic.003G152200.1 [2.1] / Sb03g013220 [1.4])
Entry ID 852
Creation 2006-01-06 (Christophe Dunand)
Last sequence changes 2006-01-06 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx63 (Sobic.003G152200.1 [2.1] / Sb03g013220 [1.4])
Name (synonym) SbPrx63 (Sobic.003G152200.1 [2.1] / Sb03g013220 [1.4])
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Callus
Cell culture
Leaves
Roots
Seedlings
Inducers Acid treatment
Alkaline treatment
Dark growth
Ethylene treatment
Oxidative stress
Phosphate starvation
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx63
start..stop
S start..stop
SiPrx03 606 0 7..366 5..355
ZmPrx143 600 0 1..369 1..357
BdiPrx67 554 0 9..353 9..344
OsPrx16 472 4e-168 22..341 18..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16199259..16199483 225 N° 2 16200933..16201823 891  
join(16199259..16199483,16200933..16201823)


exon

Literature and cross-references SbPrx63 (Sobic.003G152200.1 [2.1] / Sb03g013220 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_3 (16199259..16201823)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.3753.1 UniGene:   Sbi.13245
Protein sequence: SbPrx63 (Sobic.003G152200.1 [2.1] / Sb03g013220 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   371 (344)
PWM (Da):   %s   38878.47 (36132.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.31 (7.31) Peptide Signal:   %s   cut: 28 range:28-371
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEAARSYFFVAAVAVVLIALLPASAIAAGLKVGFYNKSCPSAEALVQQAVAAAFKNDSGIAAGLIRLHFHDCFVRGCDGSVLIDSTANNTAEKDAPPNNPSLRGFEVIDAAKAAIEAQCPKTVSCADILAFAARDSVALSSSSASGSGKNLTYKVPAGRRDGRVSRDTDANSNLPSPLSTAAELVGNFTRKNLTAEDMVVLSGAHTVGRSHCSSFTNRLYGFSNGSDVDPAISSAYAFLLRSICPSNTTRFFPPNTTTDMDLITPAVLDNKYYVGLTNNLGLFTSDQALLTNATLKKSVDEFVKSDSKWKSKFAKSMVKMGNIEVLTGTQGEIRLSCRVINNGAGSSSSSAGLFELQMTTDNSAQEESAAN*

Retrieve as FASTA  
Remarks Complete sequence from 20 ESTs and genomic (with softberry prediction)(intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTGCGCGTAGCTACTTCTTCGTCGCCGCGGTTGCCGTCGTCCTTATTGCGCTTCTCCCGGCCAGCGCCATAGCCGCCGGCCTCAAGGTCGGCTTCTACAACAAGTCATGCCCG
TCGGCGGAGGCCCTGGTGCAGCAGGCGGTGGCTGCCGCCTTCAAGAACGACAGCGGCATCGCCGCCGGCCTCATCCGCCTGCACTTCCATGACTGCTTCGTCAGG
GTACGTGCTGCGTGC
TTCCTCTTCGTCTTTGCTTCTGCATGCATTTCCATTTCCACTGTCTGTTTGCCCAGCGGTAATGTTTGGCTTATGCACCATGTACCTGTTTTTGCATAGTTCAGACATGGTTGCTTATTA
TTCATGTTTTCGGGAGATGAAGCAAGGCGTAATAATCAATTATTAATTAAACTAAACCCATTAACAGCAGGAAATTAAAGGATTGCTACCATGCATACTCCACTGTATCTGTATTTTGAA
TACTGACACAAATCTAATATGCAATTCTAACTGCTATTTTTTTTATAGAAGTAGTAATAGAAAAATTTGTATAACTGTTATCATAGTACAGTAAATGCAAGTCTCTGATCCACATCGATC
CTGTCTAACCACTCTTCGAACAACGAAGTAAACACTGACACGTACATATATGCATGAGGACAAACGGTACTGTCTAATTATGGTCATGTGCAGTTTAGACGGACTACCTCCATCTAGGAA
AGCAAGGAACAAAACAGATCAGCAATACCATTTTTGCAGTCTTCCAAAAAAAAAAGAGGGGGGAGGTGTATCGGTTTTAGCATAATACAGACATGAGAAGCAGACATATGGGAGTAGGTT
TTGCTTGGCAATAGTTATTGATCTGTTCATTAGTGAAGCACACCATGTCTACGTCATGAGCTCTATTAGGCATGTACTTTCCTTACGGTTGTGACTTGAATACGTACAGTAGCTATCATA
ATTCAGATGACTGAACATCTTTCAGACAAACAATGATATAATATGAAAAAAAAACGTGTAATGAAGTGGATCTTAAATGGATGAAGTTAGCAACCCCAATCACATTTTAATTTGTTTCGG
TACCGTCGTCGAATAGTGGTTGCCAACTGCCCAACACAGGCAACAAATTAAACAAGTGTACTTGTTGCACACATGTATCTCGATGTGTGTACTGTACAGTACTTGTTGCTGGTCCCAACC
TCCCAGGCAGACATATGTCGAGTGTTTGTGTATGGCATGGACAAATACAGAGACAGATGACCTTGACCTTGATGACTTGTGGCGAGCACTGCACTTCCTCTTGGGCACAGTTGGCAAGAC
AGGCACATGATGTGGACAAACTATCCCGGTGAAGGACGACCAGTTGGGATGCACACGGACCATGGACCAACGACCATGGCACATGCATGCACACCAAATAGTTCATCGCCAACTACTATA
TTATACTGCAGTAATGCTTTTAGAATTAATTATTAGGGGTTGATCTTCTTGCCTTGCTAGAACTAGCAGCATGGACAGAGATGACGAAGTAATTAATTAAGATCATGCATACATGTGAAT
GAAAGAAAATAAAATAAAATATCCACGGCGGATGAATTACACTACATCTACACGCACACGTACACGCGTACGCATCAATACAACATCGTAAGGGATGACGCATCATGCATGCAGGGCTGC
GACGGCTCGGTGCTGATCGACTCGACGGCGAACAACACGGCGGAGAAGGACGCGCCCCCGAACAACCCGAGCCTTCGTGGCTTCGAGGTCATCGACGCCGCCAAGGCGGCGATCGAGGCG
CAGTGCCCCAAGACGGTCTCGTGCGCCGACATCCTGGCGTTCGCGGCGCGGGACAGCGTCGCGCTGTCGTCGTCGTCGGCGTCGGGGAGCGGCAAGAACCTGACGTACAAGGTCCCCGCG
GGGCGGCGCGACGGGCGGGTGTCGAGGGACACGGACGCCAACAGCAACCTCCCCTCGCCGCTCTCCACCGCCGCCGAGCTCGTCGGCAACTTCACGCGCAAGAACCTCACCGCCGAGGAC
ATGGTGGTGCTCTCCGGCGCGCACACCGTCGGCCGCTCCCACTGCTCCTCCTTCACCAACCGCCTCTACGGCTTCAGCAACGGCAGCGACGTCGACCCGGCCATCAGCTCCGCCTACGCC
TTCCTGCTCAGGAGCATCTGCCCCTCCAACACCACCCGCTTCTTCCCCCCCAACACCACCACGGACATGGACCTCATCACGCCCGCCGTGCTCGACAACAAGTACTACGTGGGGCTCACC
AACAACCTCGGGCTCTTCACGTCGGACCAGGCGCTGCTCACCAACGCCACGCTCAAGAAGTCCGTCGATGAGTTCGTCAAGAGCGACAGCAAGTGGAAGAGCAAGTTCGCCAAGTCCATG
GTCAAGATGGGCAACATCGAGGTGCTCACGGGCACGCAGGGGGAGATCAGGCTCAGCTGCAGGGTCATCAACAACGGCGCCGGCAGCAGCAGCAGCAGCGCTGGATTATTCGAGCTTCAA
ATGACAACCGACAACTCTGCTCAGGAGGAATCAGCAGCGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTGCGCGTAGCTACTTCTTCGTCGCCGCGGTTGCCGTCGTCCTTATTGCGCTTCTCCCGGCCAGCGCCATAGCCGCCGGCCTCAAGGTCGGCTTCTACAACAAGTCATGCCCG
TCGGCGGAGGCCCTGGTGCAGCAGGCGGTGGCTGCCGCCTTCAAGAACGACAGCGGCATCGCCGCCGGCCTCATCCGCCTGCACTTCCATGACTGCTTCGTCAGG
GGCTGCGACGGCTCG
GTGCTGATCGACTCGACGGCGAACAACACGGCGGAGAAGGACGCGCCCCCGAACAACCCGAGCCTTCGTGGCTTCGAGGTCATCGACGCCGCCAAGGCGGCGATCGAGGCGCAGTGCCCC
AAGACGGTCTCGTGCGCCGACATCCTGGCGTTCGCGGCGCGGGACAGCGTCGCGCTGTCGTCGTCGTCGGCGTCGGGGAGCGGCAAGAACCTGACGTACAAGGTCCCCGCGGGGCGGCGC
GACGGGCGGGTGTCGAGGGACACGGACGCCAACAGCAACCTCCCCTCGCCGCTCTCCACCGCCGCCGAGCTCGTCGGCAACTTCACGCGCAAGAACCTCACCGCCGAGGACATGGTGGTG
CTCTCCGGCGCGCACACCGTCGGCCGCTCCCACTGCTCCTCCTTCACCAACCGCCTCTACGGCTTCAGCAACGGCAGCGACGTCGACCCGGCCATCAGCTCCGCCTACGCCTTCCTGCTC
AGGAGCATCTGCCCCTCCAACACCACCCGCTTCTTCCCCCCCAACACCACCACGGACATGGACCTCATCACGCCCGCCGTGCTCGACAACAAGTACTACGTGGGGCTCACCAACAACCTC
GGGCTCTTCACGTCGGACCAGGCGCTGCTCACCAACGCCACGCTCAAGAAGTCCGTCGATGAGTTCGTCAAGAGCGACAGCAAGTGGAAGAGCAAGTTCGCCAAGTCCATGGTCAAGATG
GGCAACATCGAGGTGCTCACGGGCACGCAGGGGGAGATCAGGCTCAGCTGCAGGGTCATCAACAACGGCGCCGGCAGCAGCAGCAGCAGCGCTGGATTATTCGAGCTTCAAATGACAACC
GACAACTCTGCTCAGGAGGAATCAGCAGCGAACTAG

Retrieve as FASTA