Entry information : TvCIIBB09 (MnP4-short)
Entry ID 8531
Creation 2011-09-23 (Christophe Dunand)
Last sequence changes 2012-12-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-12-04 (Christophe Dunand)
Peroxidase information: TvCIIBB09 (MnP4-short)
Name (synonym) TvCIIBB09 (MnP4-short)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvCIIBB09
start..stop
S start..stop
TvCIIBB06_Gangwondo 723 0 1..364 1..364
TvCIIBB06 723 0 1..364 1..364
TvCIIBB10 635 0 12..364 52..404
TvCIIBB05_KN9522 630 0 1..364 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2292449..2292509 61 N° 2 2292042..2292381 340 N° 3 2291784..2291984 201 N° 4 2291242..2291721 480
N° 5 2291171..2291183 13  
complement(join(2291171..2291183,2291242..2291721,2291784..2291984,2292042..2292 381,2292449..2292509))


exon

Literature and cross-references TvCIIBB09 (MnP4-short)
DNA ref. JGI genome:   scaffold_10 (2292509..2291171)
Protein sequence: TvCIIBB09 (MnP4-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (343)
PWM (Da):   %s   38101.24 (35986.1)  
PI (pH):   %s   4.58 (4.51) Peptide Signal:   %s   cut: 22 range:22-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALKLFGSFVALLAALQVANGALTRRVTCATGQVTSNAACCALFPVIDDIQTNLFDGGECGEEVHESLRLTFHDAIGISPAIAKTGVFGGGGADGSIAIFADIETNFHANNGVDEIIGEQAPFIARHNLTTADFIQLAGAIGVSNCPGAPRLNVFIGRKDATQPAPDLTVPEPFDDVTKILARFEDAGKFTPAEVVALLASHTIAAADHVDPTIPGTPFDSTPELFDTQFFIETQLRGTLFPGNGSNQGEVQSPLGGELRLQSDGLLARDQRTACEWQSFVNNQAKLQSAFKAAFAKMTVLGQNTRALIDCSDVVPTPPAPASKAHFPAGLTHRDIEQACRATPFPTLPTDPGPVTTVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Incorrect prediction from JGI (last very short exon is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTCAAGCTCTTTGGTTCATTCGTCGCTCTCCTCGCGGCCCTCCAGGTCGCTAACGGTATGATATTCTCTGTTTATAAGCACGACGAGTCGCTGACATGAGTTGCGTTTCCGTTC
ATTTGCAGGTGCCCTCACCCGCCGTGTGACGTGCGCCACCGGCCAGGTCACCTCGAACGCGGCGTGCTGCGCGCTCTTCCCCGTGATCGACGACATCCAGACCAACCTCTTCGACGGCGG
CGAGTGCGGTGAGGAGGTGCACGAGTCCCTCCGCCTCACCTTCCACGACGCCATCGGCATCTCGCCCGCCATCGCCAAGACCGGTGTCTTCGGCGGCGGAGGCGCAGACGGCTCCATTGC
CATCTTCGCCGATATCGAGACGAACTTCCACGCGAACAACGGTGTGGACGAGATCATCGGCGAGCAGGCGCCCTTCATCGCCCGCCACAACCTCACCACCGCCGACTT
GTACGTTCCCTT
ATACTGGGCTTGATGGCATCATCCGTTGCTGACTCGTGAGTGCAGCATCCAGTTGGCCGGTGCCATCGGTGTCTCCAACTGCCCCGGCGCGCCCCGCCTGAACGTCTTCATCGGCCGCAA
GGACGCGACCCAGCCCGCTCCCGACCTGACGGTCCCGGAGCCGTTCGACGACGTCACCAAGATTCTCGCTCGCTTCGAGGATGCCGGCAAGTTCACCCCCGCCGAGGTCGTCGCTCTCCT
CGCCTC
GTACGTGCCCACTGATCTCTATCCTTCCGTTCGGAGAACGCATACTGACACAGGGCTTGCAGGCACACGATCGCTGCTGCCGACCACGTCGACCCCACGATCCCCGGCACTCCG
TTCGATTCTACCCCCGAGCTGTTCGACACCCAGTTCTTCATCGAGACCCAGCTCCGCGGCACGCTCTTCCCCGGGAACGGCAGCAACCAGGGTGAGGTCCAGTCCCCGCTCGGCGGCGAG
CTCCGCCTCCAGTCCGATGGCCTGCTCGCTCGTGACCAGCGCACGGCCTGCGAGTGGCAGTCGTTCGTGAACAACCAGGCGAAGCTACAGTCCGCGTTCAAGGCCGCGTTCGCGAAGATG
ACCGTGCTCGGCCAGAACACACGCGCGCTCATCGACTGCTCGGACGTCGTGCCGACCCCGCCCGCCCCCGCGAGCAAGGCGCACTTCCCCGCTGGGCTCACGCACCGCGACATCGAGCAG
GCGTGCCGCGCGACGCCCTTCCCGACGCTCCCGACTGACCCCGGACCGGTCACCACCGTCGCCCCTGT
GTAAGTCCTCCCATCCTCTGATTGACCTCAGGGATGGCGCTGAACCGTCTTT
TTGCAGTCCTCCGTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTCAAGCTCTTTGGTTCATTCGTCGCTCTCCTCGCGGCCCTCCAGGTCGCTAACGGTGCCCTCACCCGCCGTGTGACGTGCGCCACCGGCCAGGTCACCTCGAACGCGGCGTGC
TGCGCGCTCTTCCCCGTGATCGACGACATCCAGACCAACCTCTTCGACGGCGGCGAGTGCGGTGAGGAGGTGCACGAGTCCCTCCGCCTCACCTTCCACGACGCCATCGGCATCTCGCCC
GCCATCGCCAAGACCGGTGTCTTCGGCGGCGGAGGCGCAGACGGCTCCATTGCCATCTTCGCCGATATCGAGACGAACTTCCACGCGAACAACGGTGTGGACGAGATCATCGGCGAGCAG
GCGCCCTTCATCGCCCGCCACAACCTCACCACCGCCGACTT
CATCCAGTTGGCCGGTGCCATCGGTGTCTCCAACTGCCCCGGCGCGCCCCGCCTGAACGTCTTCATCGGCCGCAAGGAC
GCGACCCAGCCCGCTCCCGACCTGACGGTCCCGGAGCCGTTCGACGACGTCACCAAGATTCTCGCTCGCTTCGAGGATGCCGGCAAGTTCACCCCCGCCGAGGTCGTCGCTCTCCTCGCC
TC
GCACACGATCGCTGCTGCCGACCACGTCGACCCCACGATCCCCGGCACTCCGTTCGATTCTACCCCCGAGCTGTTCGACACCCAGTTCTTCATCGAGACCCAGCTCCGCGGCACGCTC
TTCCCCGGGAACGGCAGCAACCAGGGTGAGGTCCAGTCCCCGCTCGGCGGCGAGCTCCGCCTCCAGTCCGATGGCCTGCTCGCTCGTGACCAGCGCACGGCCTGCGAGTGGCAGTCGTTC
GTGAACAACCAGGCGAAGCTACAGTCCGCGTTCAAGGCCGCGTTCGCGAAGATGACCGTGCTCGGCCAGAACACACGCGCGCTCATCGACTGCTCGGACGTCGTGCCGACCCCGCCCGCC
CCCGCGAGCAAGGCGCACTTCCCCGCTGGGCTCACGCACCGCGACATCGAGCAGGCGTGCCGCGCGACGCCCTTCCCGACGCTCCCGACTGACCCCGGACCGGTCACCACCGTCGCCCCT
GT
TCCTCCGTCGTAA

Retrieve as FASTA