Entry information : TvCIIBB05 (MnP6-short)
Entry ID 8532
Creation 2011-09-23 (Christophe Dunand)
Last sequence changes 2012-04-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-10-05 (Christophe Dunand)
Peroxidase information: TvCIIBB05 (MnP6-short)
Name (synonym) TvCIIBB05 (MnP6-short)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvCIIBB05
start..stop
S start..stop
TvCIIBB05_KN9522 731 0 1..364 1..364
TvCIIBB09 658 0 1..364 1..364
TvCIIBB06_Gangwondo 658 0 1..364 1..364
TvCIIBB06 657 0 1..364 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2303472..2303532 61 N° 2 2303594..2303933 340 N° 3 2303992..2304192 201 N° 4 2304257..2304498 242
N° 5 2304563..2304800 238 N° 6 2304857..2304869 13  
join(2303472..2303532,2303594..2303933,2303992..2304192,2304257..2304498,2304563 ..2304800,2304857..2304869)


exon

Literature and cross-references TvCIIBB05 (MnP6-short)
DNA ref. JGI genome:   scaffold_10 (2303472..2304869)
Protein sequence: TvCIIBB05 (MnP6-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364
PWM (Da):   %s   38179.15  
PI (pH):   %s   4.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKLLASFVSVLAALQLANGAATRKVTCAGGQVTANAACCALFPVLEDIQTNLFDGGECGEEVHESLRLTFHDAIGISPAIARTGKFGGGGADGSIAIFADIETNFHANNGVDEIIGEQAPFIARHNLTTADFIQFAGAIGVSNCPGAPRLNVFIGRKDATKPAPDLTVPEPFDDVTKILGRFEDAGKFTPAEVVALLASHTIAAADHVDPTIPGTPFDSTPELFDTQFFIETQLRGTLFPGNGSNQGEVMSPLHGELRLQSDAELARDARTACEWQSFNNQAKLQSAFKAAFAKMTVLGQNTRELIDCSDVVPTPPAPASAAHFPAGLTHRDVEQACRQTPFPALRTDPGPATSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCAAGCTCCTGGCATCTTTTGTCTCTGTCCTCGCGGCCCTCCAGCTCGCTAACGGTACGATTTCTGCGGCCTCCGAGCTCGAGCATCCACTTATATGAGCCGTTCCCCTCTTC
AGGTGCCGCCACCCGCAAGGTGACGTGCGCCGGCGGCCAGGTCACTGCCAACGCGGCGTGCTGTGCCCTCTTCCCCGTCCTCGAGGACATCCAGACGAACCTTTTCGACGGCGGCGAGTG
CGGTGAGGAGGTCCACGAGTCCCTCCGTCTCACCTTCCACGACGCCATCGGCATCTCGCCCGCCATCGCCCGCACTGGAAAGTTCGGAGGTGGAGGCGCAGACGGTTCTATCGCCATCTT
TGCGGACATCGAGACGAACTTCCACGCGAACAACGGTGTGGACGAGATCATCGGCGAGCAGGCGCCGTTCATCGCCCGCCACAACCTGACCACCGCCGACTT
GTACGTGGCTGGCATTGC
AACTACTCCGCTCTCTCACACCACTGACCTCCCGATCCAGCATCCAGTTCGCTGGCGCGATCGGTGTGAGCAACTGCCCCGGCGCACCCCGCCTGAACGTCTTCATCGGCCGCAAGGACG
CGACGAAGCCGGCGCCCGACCTGACGGTGCCCGAGCCGTTCGACGATGTGACCAAGATCCTTGGGCGCTTCGAGGATGCGGGCAAGTTCACCCCTGCCGAGGTCGTCGCTCTCCTCGCGT
C
GTACGTCTCCCCATCCATACCTGCTCTCCCTGTGTGAGAACATACACTTACACACGACTTGTAGGCACACGATCGCTGCTGCAGACCACGTCGACCCGACCATTCCGGGAACGCCATTC
GACTCGACCCCTGAACTGTTCGACACCCAGTTCTTCATCGAGACCCAGCTCCGCGGCACGCTCTTCCCCGGCAACGGCAGCAACCAGGGCGAGGTCATGTCTCCTCTCCACGGCGAGCTC
CGTCTCCAGTCCGACGCTGAGCTTGCACGCGACGCCCGTACCGCCTGCGAGTGGCAGTCTTTCGTCA
GTGCGTGGATATACCTTTCCTCGGTTTTCTGCGCAGTGCTCACCGCCCGCTCG
CGTATTTGTAGACAACCAGGCGAAGCTCCAGTCGGCGTTCAAGGCCGCCTTCGCGAAGATGACGGTGCTCGGCCAGAACACGCGTGAGCTCATTGACTGCTCCGACGTCGTTCCCACTCC
GCCCGCCCCCGCGAGCGCCGCGCACTTCCCCGCCGGCCTCACGCACCGCGACGTTGAGCAGGCGTGCCGCCAGACGCCCTTCCCCGCCCTCCGCACGGACCCAGGACCCGCCACCTCCGT
TGCCCCTGT
GTAAGCCCTTGTCCTCGAAAAGAATGGCGAGCCTACACTGACACCCATTTTTGTAGCCCCCCGTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCAAGCTCCTGGCATCTTTTGTCTCTGTCCTCGCGGCCCTCCAGCTCGCTAACGGTGCCGCCACCCGCAAGGTGACGTGCGCCGGCGGCCAGGTCACTGCCAACGCGGCGTGC
TGTGCCCTCTTCCCCGTCCTCGAGGACATCCAGACGAACCTTTTCGACGGCGGCGAGTGCGGTGAGGAGGTCCACGAGTCCCTCCGTCTCACCTTCCACGACGCCATCGGCATCTCGCCC
GCCATCGCCCGCACTGGAAAGTTCGGAGGTGGAGGCGCAGACGGTTCTATCGCCATCTTTGCGGACATCGAGACGAACTTCCACGCGAACAACGGTGTGGACGAGATCATCGGCGAGCAG
GCGCCGTTCATCGCCCGCCACAACCTGACCACCGCCGACTT
CATCCAGTTCGCTGGCGCGATCGGTGTGAGCAACTGCCCCGGCGCACCCCGCCTGAACGTCTTCATCGGCCGCAAGGAC
GCGACGAAGCCGGCGCCCGACCTGACGGTGCCCGAGCCGTTCGACGATGTGACCAAGATCCTTGGGCGCTTCGAGGATGCGGGCAAGTTCACCCCTGCCGAGGTCGTCGCTCTCCTCGCG
TC
GCACACGATCGCTGCTGCAGACCACGTCGACCCGACCATTCCGGGAACGCCATTCGACTCGACCCCTGAACTGTTCGACACCCAGTTCTTCATCGAGACCCAGCTCCGCGGCACGCTC
TTCCCCGGCAACGGCAGCAACCAGGGCGAGGTCATGTCTCCTCTCCACGGCGAGCTCCGTCTCCAGTCCGACGCTGAGCTTGCACGCGACGCCCGTACCGCCTGCGAGTGGCAGTCTTTC
GTCA
ACAACCAGGCGAAGCTCCAGTCGGCGTTCAAGGCCGCCTTCGCGAAGATGACGGTGCTCGGCCAGAACACGCGTGAGCTCATTGACTGCTCCGACGTCGTTCCCACTCCGCCCGCC
CCCGCGAGCGCCGCGCACTTCCCCGCCGGCCTCACGCACCGCGACGTTGAGCAGGCGTGCCGCCAGACGCCCTTCCCCGCCCTCCGCACGGACCCAGGACCCGCCACCTCCGTTGCCCCT
GT
CCCCCCGTCCTAA

Retrieve as FASTA