Entry information : TvCIIBB01 (MnP5-short)
Entry ID 8533
Creation 2011-09-23 (Christophe Dunand)
Last sequence changes 2012-04-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-02 (Christophe Dunand)
Peroxidase information: TvCIIBB01 (MnP5-short)
Name (synonym) TvCIIBB01 (MnP5-short)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvCIIBB01
start..stop
S start..stop
TvCIIBB01_PRL572 733 0 1..365 1..365
GsppCIIBB07 603 0 1..365 1..365
TvCIIBB02 573 0 1..365 1..365
TvCIIBB02_IFO30340 573 0 1..365 1..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2440361..2440421 61 N° 2 2440102..2440309 208 N° 3 2439911..2440045 135 N° 4 2439791..2439858 68
N° 5 2439682..2439735 54 N° 6 2439545..2439623 79 N° 7 2439356..2439481 126 N° 8 2439239..2439308 70
N° 9 2439140..2439185 46 N° 10 2438986..2439083 98 N° 11 2438853..2438927 75 N° 12 2438733..2438797 65
N° 13 2438662..2438674 13  
complement(join(2438662..2438674,2438733..2438797,2438853..2438927,2438986..2439 083,2439140..2439185,2439239..2439308,2439356..2439481,2439545..2439623,2439682. .2439735,2439791..2439858,2439911..2440045,2440102..2440309,2440361..2440421))


exon

Literature and cross-references TvCIIBB01 (MnP5-short)
DNA ref. JGI genome:   scaffold_2 (2440421..2442180)
Protein sequence: TvCIIBB01 (MnP5-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365
PWM (Da):   %s   38057.61  
PI (pH):   %s   4.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKTLASFVSVLAALQVASGALTRRVACPDGVNTATNAACCQLFAVRDDIQKNLFDNGECGEDVHESLRLTFHDAIGFSRSAEANGTFGGGGADGSISIFASIETNFHASLGIDEIVGEQAPFIARHNISVGDFIQFAGAVGVSNCPGAPRLQFLGRPNATQPAPDKTIPEPFDTVDSILARFLDAADFSPAEVVALLASHTIAAADEVDPTIPGTPFDSTPELFDTQFFIETQLRGTGFPGTAGNQGEVLSPLPGEMRLQSDSLARDSRTACEWQSMVNNQSKMMTAFAAAMAKLAVIGQDVSQLIDCSEIPMPPPPASAAHFPAGLSNADVEQACAETPFPTLQTDPGPETSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (12 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGACACTTGCGAGCTTCGTCTCTGTCCTTGCCGCCCTCCAGGTCGCCAGCGGTCTGTTCTTCTCCTTCTCTACTCGTTTTCAACCTGCTGACATTGCACCAGGTGCCCTT
ACCCGCCGGGTCGCTTGCCCCGACGGCGTGAACACGGCTACCAACGCGGCGTGCTGCCAGCTCTTCGCCGTCCGCGATGACATCCAGAAGAACCTGTTCGACAACGGCGAGTGCGGTGAG
GACGTCCACGAGTCCCTCCGTCTCACCTTCCACGACGCCATTGGCTTCTCCCGCTCTGCGGAGGCTAACGGCACCTTCGG
GTGGGTCCATACACCTATCACGACGTCGAAGCGTTGCTGA
ATCCTTCTCTTCACAGCGGCGGCGGCGCGGACGGCTCGATCTCCATCTTCGCGTCCATCGAGACCAACTTCCACGCGAGTCTTGGTATCGACGAGATCGTCGGCGAGCAGGCACCTTTCA
TTGCCCGCCACAACATCAGCGTCGGCGACTT
GTACGTCTTCTACTGCTATATCTCGAACCTCTCCTAACACAAAGTCGTGCAGCATCCAGTTCGCTGGAGCCGTCGGTGTCAGCAACTGC
CCTGGCGCCCCGCGCCTGCAGTTCCTGCTTG
GTGGGTTACCAACTCTCCAAAGCCTTGGTTCTTTACTGAGCCGCGTCTATCCCAGGCCGTCCTAACGCCACTCAGCCCGCGCCCGACAA
GACCATCCCGGAGCCGTTCG
GTAGGAATCAAGAAACGGCGTGGCCTGTAAGGAGTTACTGACGCGTTCGCAACACTAGACACCGTTGATAGTATTCTCGCCCGTTTCTTGGACGCCGCTG
ACTTCAGCCCGGCGGAGGTCGTCGCTCTGCTTGCGTC
GTATGTACCCTTCGAGCTCGTCGTTTCATTCTAACACTGACGCGCACGCTCACACATCAACAGGCACACCATCGCTGCGGCCG
ACGAGGTCGACCCGACGATTCCCGGAACGCCCTTTGACTCCACGCCCGAGCTTTTCGACACCCAGTTCTTCATCGAGACTCAGCTGCGCGGCACTGGGTTCCCTGG
GTACGCTGTCCTGT
GCTATGACGCGGAACGTTACTGATGTAGAGCAGAACGGCCGGCAACCAGGGTGAGGTCTTGTCCCCTCTTCCCGGAGAGATGCGCCTGCAGTCCGACTCTGAGGTAAGATCACGCCTCGG
CGGTTGTATGCGCGGACTCAACAAATTTCTTTCTAGCTCGCTCGTGACTCTCGGACTGCCTGCGAGTGGCAGTCCATGGTCAGTAAGTATTGCTCAATTTCTCTATACTAGACTATGTCC
TGACTCGTATTTCACCAGACAACCAGTCCAAGATGATGACTGCCTTCGCGGCTGCCATGGCTAAGCTCGCAGTTATCGGCCAGGACGTCAGCCAGTTGATCGACTGCTCTGAAGTGGTGG
GTTCTCACACGTACCTTGCTGCTCTGACACATTGACCAATGTTTTCGCGAATAGATCCCGATGCCGCCGCCCCCGGCGAGCGCCGCGCACTTCCCCGCCGGACTCAGCAACGCGGACGTC
GAGCAGGCT
GTGCGTGTTTCGATGTTGATGTTCTTCCCCATGTTGCTCACGTATGCCGATTTAGTGCGCCGAGACACCCTTCCCGACTCTCCAGACCGACCCCGGACCCGAGACCTCGGT
GGCCCCGGT
GTAAGTGACTCCAATGCTATCTCACCTGCTAGGCTCTAACTCCTGGATCTCTCTCTAGCCCCCCGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGACACTTGCGAGCTTCGTCTCTGTCCTTGCCGCCCTCCAGGTCGCCAGCGGTGCCCTTACCCGCCGGGTCGCTTGCCCCGACGGCGTGAACACGGCTACCAACGCGGCG
TGCTGCCAGCTCTTCGCCGTCCGCGATGACATCCAGAAGAACCTGTTCGACAACGGCGAGTGCGGTGAGGACGTCCACGAGTCCCTCCGTCTCACCTTCCACGACGCCATTGGCTTCTCC
CGCTCTGCGGAGGCTAACGGCACCTTCGG
CGGCGGCGGCGCGGACGGCTCGATCTCCATCTTCGCGTCCATCGAGACCAACTTCCACGCGAGTCTTGGTATCGACGAGATCGTCGGCGAG
CAGGCACCTTTCATTGCCCGCCACAACATCAGCGTCGGCGACTT
CATCCAGTTCGCTGGAGCCGTCGGTGTCAGCAACTGCCCTGGCGCCCCGCGCCTGCAGTTCCTGCTTGGCCGTCCT
AACGCCACTCAGCCCGCGCCCGACAAGACCATCCCGGAGCCGTTCG
ACACCGTTGATAGTATTCTCGCCCGTTTCTTGGACGCCGCTGACTTCAGCCCGGCGGAGGTCGTCGCTCTGCTT
GCGTC
GCACACCATCGCTGCGGCCGACGAGGTCGACCCGACGATTCCCGGAACGCCCTTTGACTCCACGCCCGAGCTTTTCGACACCCAGTTCTTCATCGAGACTCAGCTGCGCGGCACT
GGGTTCCCTGG
AACGGCCGGCAACCAGGGTGAGGTCTTGTCCCCTCTTCCCGGAGAGATGCGCCTGCAGTCCGACTCTGAGCTCGCTCGTGACTCTCGGACTGCCTGCGAGTGGCAGTCC
ATGGTCA
ACAACCAGTCCAAGATGATGACTGCCTTCGCGGCTGCCATGGCTAAGCTCGCAGTTATCGGCCAGGACGTCAGCCAGTTGATCGACTGCTCTGAAGTGATCCCGATGCCGCCG
CCCCCGGCGAGCGCCGCGCACTTCCCCGCCGGACTCAGCAACGCGGACGTCGAGCAGGCT
TGCGCCGAGACACCCTTCCCGACTCTCCAGACCGACCCCGGACCCGAGACCTCGGTGGCC
CCGGT
CCCCCCGTCTTAA

Retrieve as FASTA