Entry information : TvCIIBB02 (MnP2-short)
Entry ID 8534
Creation 2011-09-23 (Christophe Dunand)
Last sequence changes 2012-10-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-10-31 (Christophe Dunand)
Peroxidase information: TvCIIBB02 (MnP2-short)
Name (synonym) TvCIIBB02 (MnP2-short)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvCIIBB02
start..stop
S start..stop
TvCIIBB02_IFO30340 730 0 1..365 1..365
TvCIIBB02_PRL572 729 0 1..365 1..365
TvCIIBB02_KN9522 724 0 1..364 1..364
ParcCIIBB08 603 0 1..362 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2759463..2759523 61 N° 2 2759586..2759793 208 N° 3 2759855..2759989 135 N° 4 2760051..2760493 443
N° 5 2760555..2760792 238 N° 6 2760847..2760859 13  
join(2759463..2759523,2759586..2759793,2759855..2759989,2760051..2760493,2760555 ..2760792,2760847..2760859)


exon

Literature and cross-references TvCIIBB02 (MnP2-short)
DNA ref. JGI genome:   scaffold_2 (2759463..2760796)
Protein sequence: TvCIIBB02 (MnP2-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366
PWM (Da):   %s   38618.09  
PI (pH):   %s   4.1
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKTLASLLSVLVIIQVASGALTRRVACPDGVNTATNAACCQLFAVRDDIQQNLFDGGECGEEVHESLRLTFHDAIGISPSIASRGQFGGGGADGSIALFEDIETNFHANLGVDEIIDEQRPFIARHNLTTADFIQFAGAIGVSNCPGAPQLDVFIGRPDATQPAPDLTVPEPFDTVDSIIERFSDAGGFTPAEIVALLVSHTIAAADHVDPSIPGTPFDSTPEEFDTQFFIETQLRGTLFPGTGGNQGEVESPLRGELRLQSDSELARDSRTACEWQSFNNQAKLQSAFKAAFRKMTVLGHDESLLIECSELVPTPPPATSVAHFPAGLSNADVEQACAETPFPTLPTDPGPVTTVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). Incorrect prediction from JGI: the last short exon is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAAACTCTCGCCTCTCTCCTTTCGGTTCTGGTCATCATCCAGGTCGCAAGCGGTGAGCGATAGAGCGCGGTATTTCTGCTACGACGTCATCCTGATATCGTCTTACCTGCC
TAGGCGCGCTCACCCGCCGTGTCGCCTGCCCCGACGGCGTGAACACCGCTACCAACGCGGCGTGCTGCCAGCTCTTCGCTGTCCGCGACGACATCCAGCAGAACCTGTTCGATGGCGGCG
AGTGTGGCGAGGAGGTCCACGAGTCCCTCCGTCTGACCTTCCACGACGCCATCGGCATCTCTCCTTCCATCGCCTCTCGCGGCCAATTCGG
GTAACTTCATATCTCCTCTGGGCCTCCAT
ATCGTCAGGTATCTAACTTTGGTGCTCTGCAGAGGCGGAGGTGCCGACGGCTCCATCGCCCTCTTTGAGGACATCGAAACCAACTTCCACGCCAACCTCGGTGTCGACGAGATCATCGAC
GAGCAACGGCCGTTCATCGCCCGCCACAACCTCACCACCGCCGACTT
GTTCGTGTCTTCCCCTGACATCTAGCGTGCTGTCCGAAACTGACAACACCTCCCACTGCAGCATCCAGTTCGC
CGGCGCGATCGGTGTCAGCAACTGCCCTGGCGCGCCCCAGCTGGACGTGTTCATCGGCCGCCCCGACGCGACGCAGCCCGCGCCCGACCTGACGGTGCCCGAGCCGTTCGACACCGTCGA
CAGCATCATCGAGCGGTTCTCCGACGCGGGCGGCTTCACGCCCGCCGAGATCGTCGCGCTCCTCGTGTCGCACACGATCGCGGCGGCCGACCACGTCGACCCGAGCATCCCCGGAACGCC
CTTCGACTCGACCCCGGAGGAGTTCGACACGCAGTTCTTCATCGAGACCCAGCTCCGTGGCACGCTCTTCCCCGGCACCGGCGGCAACCAGGGCGAGGTCGAGTCGCCCCTCCGCGGCGA
GCTGCGCCTCCAGTCCGACTCTGAGCTCGCGCGCGACTCTCGCACTGCTTGCGAGTGGCAGTCCTTCGTCA
GTGCGTATCTCTTTTTCTTACCCCTTGATGTATTGGGGGATACTGACGC
GTGGGAACGCAGACAATCAGGCTAAGCTCCAGTCCGCGTTCAAGGCTGCCTTCCGCAAGATGACCGTGCTCGGCCACGACGAGAGCCTGCTGATCGAGTGCTCCGAGCTCGTGCCCACGC
CCCCGCCCGCGACGAGCGTCGCGCACTTCCCCGCTGGCCTCAGCAACGCCGACGTCGAGCAGGCGTGCGCCGAGACCCCCTTCCCGACGCTCCCCACCGACCCCGGACCCGTCACCACAG
TCGCCCCCGT
GTAAGTGCCTGATCGCTCGAGTATGTCGCCCGGCGCTGACTTGTATCCTTGCAGCCCCCCGTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAAACTCTCGCCTCTCTCCTTTCGGTTCTGGTCATCATCCAGGTCGCAAGCGGCGCGCTCACCCGCCGTGTCGCCTGCCCCGACGGCGTGAACACCGCTACCAACGCGGCG
TGCTGCCAGCTCTTCGCTGTCCGCGACGACATCCAGCAGAACCTGTTCGATGGCGGCGAGTGTGGCGAGGAGGTCCACGAGTCCCTCCGTCTGACCTTCCACGACGCCATCGGCATCTCT
CCTTCCATCGCCTCTCGCGGCCAATTCGG
AGGCGGAGGTGCCGACGGCTCCATCGCCCTCTTTGAGGACATCGAAACCAACTTCCACGCCAACCTCGGTGTCGACGAGATCATCGACGAG
CAACGGCCGTTCATCGCCCGCCACAACCTCACCACCGCCGACTT
CATCCAGTTCGCCGGCGCGATCGGTGTCAGCAACTGCCCTGGCGCGCCCCAGCTGGACGTGTTCATCGGCCGCCCC
GACGCGACGCAGCCCGCGCCCGACCTGACGGTGCCCGAGCCGTTCGACACCGTCGACAGCATCATCGAGCGGTTCTCCGACGCGGGCGGCTTCACGCCCGCCGAGATCGTCGCGCTCCTC
GTGTCGCACACGATCGCGGCGGCCGACCACGTCGACCCGAGCATCCCCGGAACGCCCTTCGACTCGACCCCGGAGGAGTTCGACACGCAGTTCTTCATCGAGACCCAGCTCCGTGGCACG
CTCTTCCCCGGCACCGGCGGCAACCAGGGCGAGGTCGAGTCGCCCCTCCGCGGCGAGCTGCGCCTCCAGTCCGACTCTGAGCTCGCGCGCGACTCTCGCACTGCTTGCGAGTGGCAGTCC
TTCGTCA
ACAATCAGGCTAAGCTCCAGTCCGCGTTCAAGGCTGCCTTCCGCAAGATGACCGTGCTCGGCCACGACGAGAGCCTGCTGATCGAGTGCTCCGAGCTCGTGCCCACGCCCCCG
CCCGCGACGAGCGTCGCGCACTTCCCCGCTGGCCTCAGCAACGCCGACGTCGAGCAGGCGTGCGCCGAGACCCCCTTCCCGACGCTCCCCACCGACCCCGGACCCGTCACCACAGTCGCC
CCCGT
CCCCCCGTCGTAA

Retrieve as FASTA