Entry information : TvCIIBB04 (MnP7-short)
Entry ID 8535
Creation 2011-09-23 (Christophe Dunand)
Last sequence changes 2012-04-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-09-23 (Christophe Dunand)
Peroxidase information: TvCIIBB04 (MnP7-short)
Name (synonym) TvCIIBB04 (MnP7-short)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvCIIBB04
start..stop
S start..stop
TvCIIBB04_PRL572 737 0 1..364 1..364
TvCIIBB14_KN9522 615 0 1..364 1..364
TvCIIBB06_Gangwondo 614 0 1..364 1..364
TvCIIBB06 609 0 1..364 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2287120..2287180 61 N° 2 2286716..2287055 340 N° 3 2286463..2286663 201 N° 4 2286163..2286404 242
N° 5 2285840..2286077 238 N° 6 2285768..2285780 13  
complement(join(2285768..2285780,2285840..2286077,2286163..2286404,2286463..2286 663,2286716..2287055,2287120..2287180))


exon

Literature and cross-references TvCIIBB04 (MnP7-short)
DNA ref. JGI genome:   scaffold_10 (2287180..2285768)
Protein sequence: TvCIIBB04 (MnP7-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364
PWM (Da):   %s   38399.27  
PI (pH):   %s   4.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKLLASFVSLLAALQVANGAATKKVTCASGQVTSNAACCALFPVIDDIQANMFDGGECNEDVHESLRLTFHDAIGISRKANKAGVFGGGGADGSIAIFADIETNFHANNGVDEIIDTQAPIIARHNLTTADFIQFAGAIGVSNCPGAPRLDVFLGRKDATQPAPDLTVPEPFDDVSKILARFDDAGKFSSDEVVALLVSHTIAAADHVDPTIPGTPFDSTPGLFDTQFFIETQLQGTLFPGNGSNQGEVMSPLRGEIRLQSDFLLARDSRTACEWQSFNNQYKLQSAFKAAFRKMTILGSKEHNLIDCSDVVPTPPAPASKAHLPAGLTRQDVQQACNKKAFPTLPTDPGPVTSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCAAGCTCCTGGCTTCCTTCGTCTCTCTCCTCGCGGCCCTTCAAGTCGCGAACGGTATGTCACCCTCAATGGAGCCCGTTCACAACGGCCACTGATTTCGAGTGGTTTGTCCC
GCCAGGTGCCGCGACCAAGAAGGTGACGTGCGCCTCTGGCCAGGTCACCTCGAACGCGGCATGCTGTGCCCTCTTCCCCGTGATCGACGACATCCAGGCAAACATGTTCGACGGCGGCGA
GTGCAACGAGGACGTGCACGAGTCCCTTCGCCTCACCTTCCACGACGCCATCGGCATCTCTCGCAAGGCCAACAAGGCGGGCGTGTTCGGCGGTGGAGGCGCGGATGGCTCGATCGCCAT
CTTCGCGGACATCGAGACCAATTTCCACGCAAACAACGGTGTCGACGAGATTATCGACACGCAGGCGCCGATCATCGCTCGCCACAACCTCACCACCGCCGACTT
GTATGTCTTCCCAGG
CATCTCGATGTGACATATGGTTGACCTCGGAGTGCAGCATTCAGTTCGCTGGTGCAATCGGCGTGAGCAACTGCCCTGGCGCACCCCGTCTGGACGTCTTCCTCGGCCGTAAAGACGCGA
CTCAGCCCGCTCCCGACCTGACGGTGCCCGAGCCCTTCGACGACGTCAGCAAGATCCTCGCGCGCTTCGACGACGCTGGCAAGTTCAGCTCTGACGAGGTCGTCGCCCTGCTCGTCTC
GT
ATGTCTCCTGTGCTCGCCCTCGCGTTAGACCAACGCTGACATAGAACACTTTGCAGGCACACGATCGCCGCTGCCGACCACGTCGACCCGACCATCCCTGGCACGCCATTCGACTCGACC
CCGGGCCTGTTCGACACCCAGTTCTTCATCGAGACCCAGCTCCAAGGCACGCTCTTCCCCGGCAACGGCAGCAACCAGGGCGAGGTCATGTCCCCGCTCCGCGGCGAGATCCGTCTCCAG
TCCGACTTCTTGCTCGCGCGCGACTCACGCACCGCCTGCGAGTGGCAGTCCTTCGTCA
GTACGTACAACATTTCTTCTCACTGCCTTCCTAGCCCGCCCCTGCACCTTATCCCAGTGCTG
ACCTGCTCCGCGCGCGCCCGCAGACAACCAGTACAAGCTCCAGTCCGCGTTCAAGGCCGCGTTCAGGAAGATGACCATCCTCGGAAGCAAGGAGCACAACCTCATCGACTGCTCGGACGT
CGTCCCGACCCCGCCCGCCCCCGCGAGCAAAGCGCACCTTCCGGCAGGCCTCACTCGCCAGGACGTCCAGCAGGCGTGCAACAAGAAGGCGTTCCCCACCCTCCCCACCGACCCCGGACC
GGTCACCTCCGTCGCCCCTGT
GTAAGTGCCCCTGCTTTTCGCACGGCACACATATACTGACATGTCGACTTGTCTTGCAGTCCCCCTTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCAAGCTCCTGGCTTCCTTCGTCTCTCTCCTCGCGGCCCTTCAAGTCGCGAACGGTGCCGCGACCAAGAAGGTGACGTGCGCCTCTGGCCAGGTCACCTCGAACGCGGCATGC
TGTGCCCTCTTCCCCGTGATCGACGACATCCAGGCAAACATGTTCGACGGCGGCGAGTGCAACGAGGACGTGCACGAGTCCCTTCGCCTCACCTTCCACGACGCCATCGGCATCTCTCGC
AAGGCCAACAAGGCGGGCGTGTTCGGCGGTGGAGGCGCGGATGGCTCGATCGCCATCTTCGCGGACATCGAGACCAATTTCCACGCAAACAACGGTGTCGACGAGATTATCGACACGCAG
GCGCCGATCATCGCTCGCCACAACCTCACCACCGCCGACTT
CATTCAGTTCGCTGGTGCAATCGGCGTGAGCAACTGCCCTGGCGCACCCCGTCTGGACGTCTTCCTCGGCCGTAAAGAC
GCGACTCAGCCCGCTCCCGACCTGACGGTGCCCGAGCCCTTCGACGACGTCAGCAAGATCCTCGCGCGCTTCGACGACGCTGGCAAGTTCAGCTCTGACGAGGTCGTCGCCCTGCTCGTC
TC
GCACACGATCGCCGCTGCCGACCACGTCGACCCGACCATCCCTGGCACGCCATTCGACTCGACCCCGGGCCTGTTCGACACCCAGTTCTTCATCGAGACCCAGCTCCAAGGCACGCTC
TTCCCCGGCAACGGCAGCAACCAGGGCGAGGTCATGTCCCCGCTCCGCGGCGAGATCCGTCTCCAGTCCGACTTCTTGCTCGCGCGCGACTCACGCACCGCCTGCGAGTGGCAGTCCTTC
GTCA
ACAACCAGTACAAGCTCCAGTCCGCGTTCAAGGCCGCGTTCAGGAAGATGACCATCCTCGGAAGCAAGGAGCACAACCTCATCGACTGCTCGGACGTCGTCCCGACCCCGCCCGCC
CCCGCGAGCAAAGCGCACCTTCCGGCAGGCCTCACTCGCCAGGACGTCCAGCAGGCGTGCAACAAGAAGGCGTTCCCCACCCTCCCCACCGACCCCGGACCGGTCACCTCCGTCGCCCCT
GT
TCCCCCTTCTTAA

Retrieve as FASTA