Entry information : TvCIIBB10 (MnP9-short)
Entry ID 8536
Creation 2011-09-23 (Christophe Dunand)
Last sequence changes 2011-09-23 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2017-09-08 (Catherine Mathe)
Peroxidase information: TvCIIBB10 (MnP9-short)
Name (synonym) TvCIIBB10 (MnP9-short)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvCIIBB10
start..stop
S start..stop
TvCIIBB09 635 0 52..404 12..364
TvCIIBB06 634 0 50..404 10..364
TvCIIBB06_Gangwondo 630 0 50..404 10..364
TvCIIBB05_KN9522 626 0 50..404 10..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2309224..2309404 181 N° 2 2309464..2309803 340 N° 3 2309863..2310063 201 N° 4 2310120..2310361 242
N° 5 2310426..2310663 238 N° 6 2310719..2310731 13  
join(2309224..2309404,2309464..2309803,2309863..2310063,2310120..2310361,2310426 ..2310663,2310719..2310731)


exon

Literature and cross-references TvCIIBB10 (MnP9-short)
DNA ref. JGI genome:   scaffold_10 (2309224..2310731)
Protein sequence: TvCIIBB10 (MnP9-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   404
PWM (Da):   %s   42895.68  
PI (pH):   %s   5.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLPQVQLYVDKDRVHIKATTKPQKALRPSSSLPPSCKTSGNGFQAPRILRVLAALQVTNGALTRKVTCAGGQVTANAACCALFPVLEDIQTNLFDGGECGEEVHESLRLTFHDAIGISPAISRTGKFGGGGADGSIAIFADIETNFHANNGVDEIIGEQAPFIARHNLTTADFIQFAGAIGVSNCPGAPRLDVFIGRKDATQPAPDLTVPEPFDDVTKILERFFDAGKFTPAEVVALLASHTIAAADHVDPTIPGTPFDSTPELFDTQFFIETQLRGTLFPGNGSNQGEVMSPLHGELRLQSDAELARDIRTSCEWQSFNNQAKLQSAFKAAFAKMTVLGQNTRNLIDCSDVVPTPPPAASKAHFPAGLTHRDVEQACFFAPFPTLPTDPGPATSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic. 5' end doesn't match with other sequences. Frameshit needed to have correct protein (start at 2309348 and framshift after 10AA) but not confirmed with SRA data
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCTGCCACAGGTTCAGCTCTACGTGGATAAAGACCGAGTGCATATAAAGGCGACCACGAAACCTCAGAAAGCCCTCAGGCCATCGAGCTCTCTTCCCCCATCCTGCAAAACCTCG
GGTAATGGCTTTCAGGCTCCTCGCATCCTTCGTGTCCTCGCGGCTCTCCAGGTCACCAACG
GTACGACGTTCCACCCCGCACGCAGACCACCCACTAACACGCACCGTTTCTCCGGCCAG

GTGCGCTCACCCGCAAGGTGACGTGCGCGGGCGGCCAGGTCACCGCGAACGCGGCGTGCTGCGCGCTCTTCCCCGTCCTCGAGGACATCCAGACGAACCTCTTCGACGGCGGCGAGTGCG
GCGAGGAGGTGCACGAGTCCCTCCGGCTTACCTTCCACGACGCCATCGGCATCTCCCCAGCTATCTCGCGCACCGGCAAGTTCGGAGGTGGGGGCGCGGACGGTTCCATTGCCATCTTCG
CGGATATCGAGACGAACTTCCACGCGAACAATGGGGTGGACGAGATTATTGGGGAGCAGGCGCCGTTCATCGCGCGCCATAACCTCACCACGGCCGACTT
GTACGTGGTCTGTTTTTTGC
GTCGCGGTAGGGTCGCGTGTGGTTAACCGGAGAGTGCAGCATCCAGTTTGCTGGGGCGATTGGGGTGAGCAACTGCCCTGGCGCGCCCCGCCTGGACGTCTTCATTGGCCGCAAGGACGC
CACCCAGCCCGCGCCCGACCTGACGGTCCCTGAGCCGTTCGACGATGTCACCAAGATCCTCGAGCGCTTTTTCGACGCCGGCAAGTTCACACCCGCCGAGGTCGTCGCTCTGCTCGCCTC
GTATGTCTTCAGTGCTCTCATCTCAGGTCGAGATCACGCTCACGCGCGCCTCGCAGGCACACGATCGCCGCTGCTGACCACGTCGACCCGACCATCCCCGGCACGCCATTCGACTCGACG
CCCGAGTTGTTCGACACGCAGTTCTTCATCGAGACGCAGCTCCGCGGCACGCTCTTCCCGGGCAACGGGAGCAACCAGGGGGAGGTGATGTCGCCGCTGCACGGCGAGCTCCGTCTCCAG
TCCGACGCGGAGCTCGCGCGCGACATCCGCACCTCGTGCGAGTGGCAGTCTTTCGTCA
GTGCGTATGCCTTCCCTTCCTCTTTTCTCTGCGGAGTGCTCACCGCGCGCTCGCGCATTTGC
AGACAACCAGGCGAAGCTCCAGTCCGCGTTCAAGGCGGCGTTCGCGAAAATGACCGTGCTGGGCCAGAATACGCGCAATCTGATTGACTGCTCGGACGTCGTGCCGACCCCGCCGCCGGC
CGCGAGTAAGGCGCACTTCCCGGCTGGGCTCACGCACCGGGACGTTGAGCAGGCGTGCTTCTTTGCGCCGTTCCCGACTCTCCCGACTGACCCCGGACCGGCTACGTCCGTCGCTCCCGT
GTAGGTTTTTTGTGATTCCTGAACGGCACGCATACGCTGACGCGTCTACTTTCAGCCCCCCATCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCTGCCACAGGTTCAGCTCTACGTGGATAAAGACCGAGTGCATATAAAGGCGACCACGAAACCTCAGAAAGCCCTCAGGCCATCGAGCTCTCTTCCCCCATCCTGCAAAACCTCG
GGTAATGGCTTTCAGGCTCCTCGCATCCTTCGTGTCCTCGCGGCTCTCCAGGTCACCAACG
GTGCGCTCACCCGCAAGGTGACGTGCGCGGGCGGCCAGGTCACCGCGAACGCGGCGTGC
TGCGCGCTCTTCCCCGTCCTCGAGGACATCCAGACGAACCTCTTCGACGGCGGCGAGTGCGGCGAGGAGGTGCACGAGTCCCTCCGGCTTACCTTCCACGACGCCATCGGCATCTCCCCA
GCTATCTCGCGCACCGGCAAGTTCGGAGGTGGGGGCGCGGACGGTTCCATTGCCATCTTCGCGGATATCGAGACGAACTTCCACGCGAACAATGGGGTGGACGAGATTATTGGGGAGCAG
GCGCCGTTCATCGCGCGCCATAACCTCACCACGGCCGACTT
CATCCAGTTTGCTGGGGCGATTGGGGTGAGCAACTGCCCTGGCGCGCCCCGCCTGGACGTCTTCATTGGCCGCAAGGAC
GCCACCCAGCCCGCGCCCGACCTGACGGTCCCTGAGCCGTTCGACGATGTCACCAAGATCCTCGAGCGCTTTTTCGACGCCGGCAAGTTCACACCCGCCGAGGTCGTCGCTCTGCTCGCC
TC
GCACACGATCGCCGCTGCTGACCACGTCGACCCGACCATCCCCGGCACGCCATTCGACTCGACGCCCGAGTTGTTCGACACGCAGTTCTTCATCGAGACGCAGCTCCGCGGCACGCTC
TTCCCGGGCAACGGGAGCAACCAGGGGGAGGTGATGTCGCCGCTGCACGGCGAGCTCCGTCTCCAGTCCGACGCGGAGCTCGCGCGCGACATCCGCACCTCGTGCGAGTGGCAGTCTTTC
GTCA
ACAACCAGGCGAAGCTCCAGTCCGCGTTCAAGGCGGCGTTCGCGAAAATGACCGTGCTGGGCCAGAATACGCGCAATCTGATTGACTGCTCGGACGTCGTGCCGACCCCGCCGCCG
GCCGCGAGTAAGGCGCACTTCCCGGCTGGGCTCACGCACCGGGACGTTGAGCAGGCGTGCTTCTTTGCGCCGTTCCCGACTCTCCCGACTGACCCCGGACCGGCTACGTCCGTCGCTCCC
GT
CCCCCCATCCTAA

Retrieve as FASTA