Entry information : TvCIIBA11 (MnP11-short)
Entry ID 8537
Creation 2011-09-23 (Christophe Dunand)
Last sequence changes 2011-09-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-02-02 (Christophe Dunand)
Peroxidase information: TvCIIBA11 (MnP11-short)
Name (synonym) TvCIIBA11 (MnP11-short)
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvCIIBA11
start..stop
S start..stop
DsCIIBA05 538 0 1..362 1..364
ParcCIIBA01 524 0 1..362 1..361
GsppCIIBA06 504 0 15..362 16..358
ParcCIIBA02 483 2e-172 20..362 20..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 145019..145126 108 N° 2 144919..144962 44 N° 3 144846..144865 20 N° 4 144762..144787 26
N° 5 144636..144694 59 N° 6 144447..144581 135 N° 7 144151..144382 232 N° 8 144033..144095 63
N° 9 143850..143962 113 N° 10 143756..143793 38 N° 11 143451..143688 238 N° 12 143374..143386 13
complement(join(143374..143386,143451..143688,143756..143793,143850..143962,1440 33..144095,144151..144382,144447..144581,144636..144694,144762..144787,144846..1 44865,144919..144962,145019..145126))


exon

Literature and cross-references TvCIIBA11 (MnP11-short)
DNA ref. JGI genome:   scaffold_12 (145126..143374)
Protein sequence: TvCIIBA11 (MnP11-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   362 (344)
PWM (Da):   %s   38492 (36624.0)  
PI (pH):   %s   4.93 (4.83) Peptide Signal:   %s   cut: 19 range:19-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFSKVFVSFLALAAVVSAVPSKRASCSKGRSASNAKCCVWFDVLDDIQTNLFDGSQGEEAHESLLTFHDAIGFSPALARQGKFGGGGADGSIMAFAQIETNFKASVGMDEIVEEQRPFALKHKVSFGDFIQFAGAVAVSNCAGGPRLQFLAGRSNHSQVSPPDLVPLPEDPVDKIFARMADAGFSPNELVDLLASHTVAAQDQINNVHGSPFDSTPSTFDAQFYVETLLKGTAFSGNDTTANVGEAKSPIPGEFRLASDDLIARDPRSACEWQSFTNQKLMVERFTQAMAKMSTLGNNVYELVDCSEVIPVPSKAASNVAHFPDGKTIKDIEQSCKGTPFPVLQTQAGPTSVPVVPDS

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTTCTAAAGTCTTCGTATCGTTCCTCGCTCTCGCCGCGGTCGTCTCTGCGGTCCCGTCGAAGAGAGCGTCCTGCAGCAAGGGTCGCAGCGCCAGCAATGCAAAGGTTGGCACTGTA
ATTGGTATCAGAGTTTGCAGGCATGCTCAACCGTTGATTTCTAGTGCTGCGTCTGGTTTGACGTCCTCGACGATATCCAGACGAACCTGTAAATATTTCTTGCCCTTCTTACATTCTATG
TTCTAATATTCTCTGCCACAGTTTCGACGGATCTCAGTGCGGTAAGACCGCCTTCCTTGAACATTGACTGCCAAATGCTCACTCCATGCGCTACTGTAGGAGAGGAAGCTCATGAGTCTC
TGCGC
GTACGTCAAAACTTTCTTGCATCCGCGCAGCTCGAGAAAATCTCCATTTACTGAACGGCGTCTGTAGTTGACTTTCCACGATGCTATCGGCTTCTCGCCTGCCCTGGCTCGCCAG
GGGAAGTTCGG
GTACGTACTACGGCCCTCCGCTCAGCGTCAACATCGTACTGATCAAATGCACAGCGGTGGTGGCGCTGACGGCTCCATCATGGCCTTCGCCCAGATCGAGACCAACTTC
AAGGCTAGCGTCGGGATGGACGAGATCGTCGAGGAGCAGCGCCCCTTCGCGCTCAAGCACAAGGTTTCCTTCGGTGACTT
GTGCGTAATAAACGCATCTCCCTCCTGCCATCATCATCAG
CATATTAATCACCTCCACCTATAGCATCCAGTTCGCTGGCGCCGTCGCCGTGAGCAACTGCGCGGGCGGCCCGCGCCTCCAGTTCCTGGCCGGACGCTCGAACCACTCGCAGGTGTCGCC
CCCGGACCTCGTCCCGCTGCCCGAGGACCCGGTCGACAAGATCTTCGCGCGCATGGCCGATGCCGGCTTCTCGCCCAACGAGCTCGTCGACCTGCTCGCGTCGCACACCGTCGCTGCGCA
GGATCAGATTAACCCG
GTCAGTGCGCGCGAATATCTTGCTTAGAGCGGTGGTACTCACACCCCGACCACAGAACGTTCACGGTAGTCCGTTTGACAGCACCCCGTCGACCTTCGATGCTC
AGTTCTACGTTGAG
GTGCGTCTTCGTCGTGACGCTCAAACGCCATAGTGGTAATCAATTATATACTTATTTCATCGTGTGCTAGACCCTCCTCAAGGGGACGGCCTTCAGTGGCAACGAT
ACCACTGCCAACGTTGGAGAGGCCAAGTCTCCCATCCCTGGGGAGTTCCGCCTCGCGTCTGACGACCTGATCGCCAG
GTGCGTTGTCCATGCATTCTGGCTGACTGATGATTTGCGCTCA
CACTCTATCCTAGGGACCCTCGCTCTGCTTGCGAGTGGCAGTCCTTCGTCAGTAAGTCGCAGATCTCCCATCCCCCTACGCCTAGAATTATTCGCTGACAACGAGACGCGCATCACAGCC
AACCAGAAGCTCATGGTGGAGCGCTTCACGCAGGCGATGGCGAAGATGTCCACGCTCGGGAACAACGTGTACGAGCTCGTCGACTGCTCCGAGGTCATCCCCGTCCCCTCCAAGGCCGCC
TCGAACGTCGCGCACTTCCCCGACGGCAAGACGATCAAGGACATCGAGCAGTCCTGCAAGGGCACGCCCTTCCCCGTCCTCCAGACCCAGGCCGGCCCGACTTCCGTCCCTGTTGT
GTGA
GTAGACTGGCCGCCAGGCATTGTTTCGATACTTCAGGAATGCTTACTTGGTTTCGTATAGCCCCGACAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTTCTAAAGTCTTCGTATCGTTCCTCGCTCTCGCCGCGGTCGTCTCTGCGGTCCCGTCGAAGAGAGCGTCCTGCAGCAAGGGTCGCAGCGCCAGCAATGCAAAGTGCTGCGTCTGG
TTTGACGTCCTCGACGATATCCAGACGAACCT
TTTCGACGGATCTCAGTGCGGAGAGGAAGCTCATGAGTCTCTGCGCTTGACTTTCCACGATGCTATCGGCTTCTCGCCTGCCCTGGCT
CGCCAGGGGAAGTTCGG
CGGTGGTGGCGCTGACGGCTCCATCATGGCCTTCGCCCAGATCGAGACCAACTTCAAGGCTAGCGTCGGGATGGACGAGATCGTCGAGGAGCAGCGCCCCTTC
GCGCTCAAGCACAAGGTTTCCTTCGGTGACTT
CATCCAGTTCGCTGGCGCCGTCGCCGTGAGCAACTGCGCGGGCGGCCCGCGCCTCCAGTTCCTGGCCGGACGCTCGAACCACTCGCAG
GTGTCGCCCCCGGACCTCGTCCCGCTGCCCGAGGACCCGGTCGACAAGATCTTCGCGCGCATGGCCGATGCCGGCTTCTCGCCCAACGAGCTCGTCGACCTGCTCGCGTCGCACACCGTC
GCTGCGCAGGATCAGATTAACCCG
AACGTTCACGGTAGTCCGTTTGACAGCACCCCGTCGACCTTCGATGCTCAGTTCTACGTTGAGACCCTCCTCAAGGGGACGGCCTTCAGTGGCAAC
GATACCACTGCCAACGTTGGAGAGGCCAAGTCTCCCATCCCTGGGGAGTTCCGCCTCGCGTCTGACGACCTGATCGCCAG
GGACCCTCGCTCTGCTTGCGAGTGGCAGTCCTTCGTCACC
AACCAGAAGCTCATGGTGGAGCGCTTCACGCAGGCGATGGCGAAGATGTCCACGCTCGGGAACAACGTGTACGAGCTCGTCGACTGCTCCGAGGTCATCCCCGTCCCCTCCAAGGCCGCC
TCGAACGTCGCGCACTTCCCCGACGGCAAGACGATCAAGGACATCGAGCAGTCCTGCAAGGGCACGCCCTTCCCCGTCCTCCAGACCCAGGCCGGCCCGACTTCCGTCCCTGTTGT
CCCC
GACAGCTAA

Retrieve as FASTA