Entry information : GclCIIAA
Entry ID 8543
Creation 2011-09-26 (Christophe Dunand)
Last sequence changes 2017-05-03 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-05-03 (Catherine Mathe)
Peroxidase information: GclCIIAA
Name GclCIIAA
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Ophiostomataceae Grosmannia
Organism Grosmannia clavigera    [TaxId: 226899 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GclCIIAA
start..stop
S start..stop
MEspCIIAA01_NRRL54901 285 2e-94 46..372 38..350
RrufCIIAA03 274 2e-89 38..378 32..363
BdotCIIAA02 267 4e-87 50..373 48..355
ClunCIIAA01 266 1e-86 34..378 30..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..1035 1035 N° 2 1166..1276 111  
join(1..1035,1166..1276)


exon

Literature and cross-references GclCIIAA
Protein ref. GenBank:   EFX02320.1 [Incorrect prediction]
DNA ref. GenBank:   ACXQ02000087.1 (335078..336353)
Protein sequence: GclCIIAA
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   381 (360)
PWM (Da):   %s   40283.8 (38222.7)  
PI (pH):   %s   6.5 (6.50) Peptide Signal:   %s   cut: 22 range:22-381
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKPGPALAIILLGGASNIADAFPASHHQQSNATQRRYLHGLTRMAQSTVLLGDLAIDGATTESGQAIQAILQGTASARVENEETYRQPLGGPHVKACHENTCCVWSHIVAQMTATFRSADGRHCTALARSAIRMGYHDAGAWNTSMPRLSAEAVAHGIGGGGADGSILLSDGELNRTENRGLQDIAHLVMSWYNVYHWSHGVSAADLIQMGALVATTACPGGPRIRAFVGRHDVEPGSPPPPHGLLPPSSSDAPWMLYVFKAKTLSPADLVALVGAHTVSRQFFVDTMYAGQAQDSTPAVFDTRFFDETTAAEKSPPGVYSFHSDMSLAADPTTQPIWASFTGENAYVAAYFRLGLLGVQNLNGLTDCSGVLPASRTTDGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Uncorrect prediction from NCBI => ORF fusion and annotated as capsule polysaccharide synthase.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACCAGGACCAGCACTCGCCATCATCCTTCTCGGTGGTGCCAGCAACATTGCTGATGCATTCCCGGCTAGCCATCACCAGCAGTCGAACGCTACCCAACGACGATACCTGCATGGC
CTCACACGCATGGCCCAGTCGACGGTCCTCCTGGGTGATCTGGCCATTGATGGGGCAACGACAGAGTCAGGCCAGGCGATTCAGGCCATCCTCCAGGGCACGGCGTCGGCCCGGGTTGAG
AACGAAGAAACATACAGACAGCCTTTGGGTGGGCCCCATGTCAAGGCTTGTCACGAAAACACATGCTGCGTCTGGAGCCACATTGTGGCGCAGATGACGGCGACATTCCGGTCAGCTGAC
GGCCGACACTGCACGGCTCTGGCACGGAGTGCGATCCGCATGGGCTACCATGATGCGGGGGCCTGGAACACGTCGATGCCACGATTGTCGGCCGAGGCAGTGGCACACGGCATCGGAGGC
GGCGGTGCGGACGGGTCAATTCTGCTGTCGGATGGCGAGCTGAATCGGACGGAAAATCGCGGACTGCAGGACATTGCCCACTTGGTGATGAGCTGGTACAATGTCTACCACTGGAGCCAT
GGGGTGTCGGCGGCGGATCTGATCCAGATGGGTGCACTTGTGGCCACGACGGCCTGTCCGGGAGGTCCACGGATCCGTGCTTTTGTGGGCCGTCACGACGTTGAGCCCGGATCACCACCG
CCACCGCATGGGCTACTGCCACCATCCTCGTCGGACGCGCCGTGGATGCTGTACGTGTTCAAGGCCAAGACGCTGTCGCCGGCTGACCTGGTGGCACTTGTGGGGGCGCATACGGTCTCG
CGGCAATTTTTTGTCGACACGATGTACGCGGGCCAGGCACAGGACTCGACGCCGGCGGTGTTTGACACGCGGTTCTTTGACGAGACGACGGCGGCCGAGAAGTCGCCCCCGGGCGTCTAC
AGCTTCCACTCAGACATGTCGCTGGCGGCAGACCCGACAACGCAGCCGATTTGGGCGAGTTTCACAGGGGAAAAC
GTGCACGGCTCATAGGTTGAGGTGAGTGGGGTGAAAGAGGGAAAG
CAGGAAAGAAAGAGGGTCAAAAAAAGCGCGAGAGGCGAGAGACAATAATAAAACAGGGCAAGCAGCTAACTGGATGACTGGACAGGCATACGTGGCCGCTTATTTCCGGCTTGGACTACT
GGGGGTGCAGAATCTGAACGGGCTGACGGATTGCAGCGGCGTTCTGCCGGCATCGAGGACGACAGACGGCAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACCAGGACCAGCACTCGCCATCATCCTTCTCGGTGGTGCCAGCAACATTGCTGATGCATTCCCGGCTAGCCATCACCAGCAGTCGAACGCTACCCAACGACGATACCTGCATGGC
CTCACACGCATGGCCCAGTCGACGGTCCTCCTGGGTGATCTGGCCATTGATGGGGCAACGACAGAGTCAGGCCAGGCGATTCAGGCCATCCTCCAGGGCACGGCGTCGGCCCGGGTTGAG
AACGAAGAAACATACAGACAGCCTTTGGGTGGGCCCCATGTCAAGGCTTGTCACGAAAACACATGCTGCGTCTGGAGCCACATTGTGGCGCAGATGACGGCGACATTCCGGTCAGCTGAC
GGCCGACACTGCACGGCTCTGGCACGGAGTGCGATCCGCATGGGCTACCATGATGCGGGGGCCTGGAACACGTCGATGCCACGATTGTCGGCCGAGGCAGTGGCACACGGCATCGGAGGC
GGCGGTGCGGACGGGTCAATTCTGCTGTCGGATGGCGAGCTGAATCGGACGGAAAATCGCGGACTGCAGGACATTGCCCACTTGGTGATGAGCTGGTACAATGTCTACCACTGGAGCCAT
GGGGTGTCGGCGGCGGATCTGATCCAGATGGGTGCACTTGTGGCCACGACGGCCTGTCCGGGAGGTCCACGGATCCGTGCTTTTGTGGGCCGTCACGACGTTGAGCCCGGATCACCACCG
CCACCGCATGGGCTACTGCCACCATCCTCGTCGGACGCGCCGTGGATGCTGTACGTGTTCAAGGCCAAGACGCTGTCGCCGGCTGACCTGGTGGCACTTGTGGGGGCGCATACGGTCTCG
CGGCAATTTTTTGTCGACACGATGTACGCGGGCCAGGCACAGGACTCGACGCCGGCGGTGTTTGACACGCGGTTCTTTGACGAGACGACGGCGGCCGAGAAGTCGCCCCCGGGCGTCTAC
AGCTTCCACTCAGACATGTCGCTGGCGGCAGACCCGACAACGCAGCCGATTTGGGCGAGTTTCACAGGGGAAAAC
GCATACGTGGCCGCTTATTTCCGGCTTGGACTACTGGGGGTGCAG
AATCTGAACGGGCTGACGGATTGCAGCGGCGTTCTGCCGGCATCGAGGACGACAGACGGCAGTTGA

Retrieve as FASTA