Entry information : CreCcP01 (Cre02.g139650.t1.1)
Entry ID 8557
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-09-27 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-06-13 (Qiang Li)
Peroxidase information: CreCcP01 (Cre02.g139650.t1.1)
Name (synonym) CreCcP01 (Cre02.g139650.t1.1)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Viridiplantae Chlorophyta Chlorophyceae Chlamydomonadaceae Chlamydomonas
Organism Chlamydomonas reinhardtii    [TaxId: 3055 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CreCcP01
start..stop
S start..stop
VcaCcP01 565 0 1..369 1..369
VauCcP01 562 0 1..372 1..370
VgCcP 550 0 1..368 1..372
CspCcP06 429 3e-152 67..366 1..295
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8823874..8824059 186 N° 2 8823222..8823344 123 N° 3 8822772..8822944 173 N° 4 8822213..8822305 93
N° 5 8821827..8821968 142 N° 6 8821401..8821500 100 N° 7 8821027..8821111 85 N° 8 8820446..8820551 106
N° 9 8820078..8820122 45 N° 10 8819688..8819753 66  
complement(join(8819688..8819753,8820078..8820122,8820446..8820551,8821027..8821 111,8821401..8821500,8821827..8821968,8822213..8822305,8822772..8822944,8823222. .8823344,8823874..8824059))


exon

Literature and cross-references CreCcP01 (Cre02.g139650.t1.1)
Literature Grossman,A., Chang,C.-W., Davies,J., Harris,E., Hauser,C., Lefebvre,P., McDermott,J.P., Shrager,J., Silflow,C. and Stern,D. Analyses of the Chlamydomonas reinhardtii Genome: A Model,Unicellular System for Analyzing Gene Function and Regulation in Vascular Plants. Project: 963
DNA ref. Phytozome 11:   chromosome_2 (8824059..8819688)
Protein sequence: CreCcP01 (Cre02.g139650.t1.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373
PWM (Da):   %s   39425.13  
PI (pH):   %s   8.89
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSAPRLVRLGALLARQGAPATSLLSAQGQAVRAFSEKAAAEAPAAAAAAASKDEAKSKIRGFQALLFGGLGAGFLYGYSLFTSKVPESGPLAGPPALVTSKPSTPGDYAAVRQSIAALLDDGDYDDGSYGPVLVRLAWHASGTYAKKDGSGGSNGATMRFAPECEWGANAGLAVARKLLEPVKAAHPWISYADLWTLAGVVAIEEMGGPTIPWRAGRSDAPDGSKIVPDGRLPDAKGAKHLREVFGRMGFDDKDIVALSGAHTLGRCHTDRSGFSGPWTNAPTTFSNLYFQELLNNKWVVKKWDGPLQYEDTKSQSLMMLPSDLALLSDRSFKKYVTQYAKDEEAFFKDFAVAFSKLLELGVPFPAKSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (Scaffold_35, 10 exons predicted with Softberry) and 14 + 13 ESTs (TC48660 and TC44953). Contig position: 46556-42185. Two other small genomic sequences (scaffold_706 and scaffold_69 from JGI sequencing project). Prediction of 35AA long signal peptide for transport in mitochondria.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCTCTGCTCCTCGCCTGGTCCGCCTGGGTGCGCTACTGGCTCGCCAGGGAGCGCCCGCGACGTCGCTGCTCTCGGCTCAGGGCCAGGCCGTGCGCGCTTTCTCCGAGAAGGCA
GCAGCCGAGGCACCTGCTGCCGCGGCCGCCGCGGCGTCGAAGGATGAGGCCAAGAGCAAGATTCGG
GTGAGCGCCAGGGGTGTGCGGCCGACGGGGTCGCAGGGGTCGCACAGCGCGGAG
CCTTCACGTTGCGCGGGGATTTCCGCGGCATGTGCGATTGCTCGGCGGTTGTCCAGCGTGAGCAGGAGCAGTTTGGGGCGTGGCCGCACTTTTAACGGCGGTCAGCTACGGCTTATACTG
TACAGAGCTTCCGGAGCTGGCACGCCTGCGCGTTGACCACACAAACCTGCCCCGGCAGACAGCTGCAACACCCTCGCACCTCTCGTGGCGCTTCCTCCGGAGTTCCTTCCTCGAGTTCCT
CCGGTGCCAACAACCCAACAGCTCAGCTGGCGCTCAGCCACCGTCCCCCTCATCCTCCTCCAAACACGCCCACGCCAAAAATGCCAGTACCCGCACCCACGCCCACATCCACGCGTCCAC
AGCGGCTCCCATGTCCTTCCGACCCACCTTCCCCGCCCGCTCCCCGGCCCTTCCCGCAATACACACACGCGCTCCCCCCCTCCCCCCTCCCTCTCCCCGCCCCCTCCTTCCACAGGGCTT
CCAGGCTCTGCTGTTCGGCGGCCTGGGCGCGGGCTTCCTGTACGGCTACTCACTGTTCACCAGCAAGGTGCCGGAGAGCGGGCCGCTGGCAGGGCCGCCCGCGCTGGTGACCAGCAAG
GT
GCGGGGCGCGGCAATGGGTTGGGGGTGGAGGAGGAGGTGGAGGTGGGGTGGGCGCATGGGCTGGGGGTGGAGGTGGGGCTGGGACAGAAGCCTGGGCTCGGGCAGTCTGGGCTGGGACTG
GGGGATGGGGCGCGGGGTCGGGGATGTGGGTCGCAGGCCGACGACCGGGTCCCACCCGTCGCTAGATAGAGCAGCCCTGGATCCGAGCCCTGGATTTTGAACAGACCATTCTCAGCCCCC
AGCGCCAACCACCGCCCTCCCTGCCCCTCCTCCAGCCCTCCACGCCCGGCGACTACGCGGCTGTGCGGCAGTCCATTGCGGCCCTGCTGGACGACGGCGACTACGACGACGGCAGCTACG
GCCCCGTGCTGGTGCGGCTGGCCTGGCACGCCTCCGGCACCTACGCCAAGAAGGACGGCAGCGGCGGCAGCAACGGGGCCACCATGCG
GTGCGTGCGGAGGCATGGGGCGTGGGGGCGGG
GGGTCGTTTGTTCCAATCTTTAGTTAACAACCAAGATTCAAAACATTTTTTCATGATTCTCAACTAGAAGCCTGACACGAAACATGAGGGGGGCAGGGGGGCGCGAGGGAGGTCTGCGGG
CTGGCGGGCTGGGGATGTGCGTGTTGGCGGAGGGGCTTGCGGTTGGGGACAGGTGATGCGAGGAAGGACGGACACAACGGTGAAGGATTGGGGTCGGATATAGGCATAGGGGAGGCGGAG
ACCGGGCATGACCTTGCCAAGCTCATGTTGAACACAAGCGGGACCCCGGGCGGGATTCAGGGTGGGTGGTCTTCTACGCCTGGCACATTGCGCGTGCGCACCGTCCACCCCTGCTTCGCT
TCACCTCACCGCCCCCGTCTCACCCCCTCCCTCCCTCCCTCACTCCCTCCCGCCACACGCATGTATGCACACAGCTTTGCTCCCGAGTGCGAGTGGGGCGCCAACGCGGGTCTGGCGGTG
GCTCGCAAGCTGCTGGAGCCCGTCAAGGCCGCGCACCCCTGGATCAG
GTGGGGCAGGGGGGGGGGGGGAGAGTGGGGGGGTTGGGTTGGGGAGCAGGGGGGATGATTGGGTTGGAGAGCA
AGGGGGGACGAGAGTTGGGTGGTTGGGGGTTGCATAGTGCATTCAATCGCAAGTTGCCGCCATGTGTGCCGGCCCACGCCCTCCTCCCTGCCACCCCCACCACTACCACCACCACCGTTA
CCACTGCACACCGTCACCACCCCCACCCCCACCCCCACCCCCACCACGCAGCTACGCCGACCTGTGGACGCTGGCGGGCGTGGTGGCCATCGAGGAGATGGGCGGCCCCACCATCCCCTG
GCGCGCCGGCCGCTCCGACGCGCCCGACGGCTCCAAGATCGTGCCGGACGGCCGCCTGCCGGACGCCAAACAG
GCGAGAGAGGGTGTGAGCGTGTGTGAGAGGGATTGAGCGTGTGTGAG
AGGGATTGAGGGACTGAGGAACTGAGGGTGTTTGTGTGGCAGCGTGTGTGGTAGGGTGCAGCGTGTGTGGTAGGGTGCGTGCTTGGGTGCTTGTGCAGCTCCCTCTGTTTGGCACACCCG
CCCGCTGGTCCCCGCCCACCTCCCTTACAACTGCCCATCCCGCCCTGTGGGCTGCTGCCTTGGGATCTGGGTCTAGCGGTTTGCTGGCCACCCGGCCTCCCCCCCCCCCAACCGTCTGTC
ATCCACCACCGCCCCCACCACCCGCCGCCTGCTGCACAGGGCGCCAAGCACCTGCGCGAGGTGTTTGGCCGCATGGGCTTTGACGACAAGGACATTGTGGCGCTCAGCGGCGCACACACG
CTGGGCCGCTGCCACACAG
GTGCGGCGGGGCAGCGGGCAGATGGAGTGGGGGGTGCGGGTTTGGAGCACCAGCCCAAACTAAACCATACCCAGCCAAACTAGCGGAGCACAAGCAGAGGC
GACAGTTGCGTTGTGGATGGATGGACATTGCGTAGAAGATGGGGCGGGCTTCATACACCTTCCCTTGAGTCCGACCCCGGTCCTCCTCTCACCCCTCCCGCCGCTTCCCTCATCCCCGCT
ACCCCCACTTCTCCAAATCCCATCCCCACCACTTCCTTAATTAATCATGAATGTAACCCCACCCGCAGACCGCAGCGGCTTCAGCGGCCCCTGGACCAACGCGCCGACCACCTTCTCCAA
CCTGTACTTCCAGGAGCTGCTCAACAACAAGTG
GTGAGCGCGAGTGTGTGTGTGGGGGGGGGATTACATTCATGATTTTTCAAGAAGTGGGGGCGGAGAGCGAGAGGGCGAGAAGGCGGA
AAGGAGCGAGAGGGGCGCCGTTGGCGAGCAGGCGGGCGTCGATTAGAGGGAGGGGCGGAGGGCCTCGCCGTAGAAGGAGCGGGACAGGGGGCGGACGGCGCACAAGGCGGTCTTGAGTGA
GGTGCGGTGCGCGCCACGCGATTCGGCGGGCTTAAGTGGACAGTCGTCACCTCTGCACTCAAGCGGAGCTATCTACTACTGTCATGCCAGCTACCACATTTATCCAATCCTGGACTCTTG
CGTGCACAGATTTCTCCATGCCATGCACGCGCGCTCCCGCCCGCCCACCTTCCACCCCCTGCGCTTGTTGATGACAACCGTGTCGCAAATGCATCCTGCACGCCACCACCCTCACCACCT
GCTCCATGACCCCCGCCCCAACCCCCAGGGTTGTCAAGAAGTGGGACGGGCCGCTGCAGTACGAGGACACCAAGAGCCAGAGCCTGATGATGCTGCCCTCTGACCTGGCGCTGCTCAGCG
ACCGCAGCTTCAAG
GTGGGGGAGGGGAGGGAGGGGAGGGGAGGGGAGGGCGCGGAATGAGGTGTGGTAGCGGAGCATTGAGTGGGCGGCATGGGCAGAGTTGTCGGATGGATGGAGAGCG
GAATGTGGGCGTGAGCTCGGTGGGGAGGCGGGGAGTAACTGATGATGAGGTCTGAAGGTGTGTTGCCCGCGTACCTCATCTTTGTCCGCATTGCCCGCCCACGTCTTCTCCACACACGCA
CAAACAGTTTGACACACACTGCATGCCCTGCTCGCCCACGCCGCCCCCCCCCCCATATTTGATACACACCATCCCATGGATGGCTACCCCCCTGCAGAAGTACGTGACCCAGTACGCCAA
GGATGAGGAGGCGTTCTTCAAG
GTGCGTGCGTGGGTTGTGTGGGGCGGCCGCGATGGCTGTGTTGAGGGCCTAGCGGTGAGGGAATAGCGGCGGTGGTGTGGGGCAGGCGGAAGCGGCAC
TTCGGTCTCGGGGCAGCCGACGCCTCTCGTGCTCACTTGCGTGATTCCTTGCACGCACACAGCCTTTGCCAGCAGTGCCGTACACCTCCCGCGTGCAACACGTGACTGGACTGGATGTAC
GGTATACACGCTCACACGTGCCGCGGGAGCCCCGGGGCGCCCACCGTCACTCCTGCGCACTTTCTTAAAACGGATTTCTGTACACGTGCTTTCCGTACACGCGCAGGACTTTGCGGTGGC
GTTCTCTAAGCTGCTGGAGCTGGGCGTGCCCTTCCCCGCCAAGAGCGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCTCTGCTCCTCGCCTGGTCCGCCTGGGTGCGCTACTGGCTCGCCAGGGAGCGCCCGCGACGTCGCTGCTCTCGGCTCAGGGCCAGGCCGTGCGCGCTTTCTCCGAGAAGGCA
GCAGCCGAGGCACCTGCTGCCGCGGCCGCCGCGGCGTCGAAGGATGAGGCCAAGAGCAAGATTCGG
GGCTTCCAGGCTCTGCTGTTCGGCGGCCTGGGCGCGGGCTTCCTGTACGGCTAC
TCACTGTTCACCAGCAAGGTGCCGGAGAGCGGGCCGCTGGCAGGGCCGCCCGCGCTGGTGACCAGCAAG
CCCTCCACGCCCGGCGACTACGCGGCTGTGCGGCAGTCCATTGCGGCCCTG
CTGGACGACGGCGACTACGACGACGGCAGCTACGGCCCCGTGCTGGTGCGGCTGGCCTGGCACGCCTCCGGCACCTACGCCAAGAAGGACGGCAGCGGCGGCAGCAACGGGGCCACCATG
CG
CTTTGCTCCCGAGTGCGAGTGGGGCGCCAACGCGGGTCTGGCGGTGGCTCGCAAGCTGCTGGAGCCCGTCAAGGCCGCGCACCCCTGGATCAGCTACGCCGACCTGTGGACGCTGGCG
GGCGTGGTGGCCATCGAGGAGATGGGCGGCCCCACCATCCCCTGGCGCGCCGGCCGCTCCGACGCGCCCGACGGCTCCAAGATCGTGCCGGACGGCCGCCTGCCGGACGCCAAACAG
GGC
GCCAAGCACCTGCGCGAGGTGTTTGGCCGCATGGGCTTTGACGACAAGGACATTGTGGCGCTCAGCGGCGCACACACGCTGGGCCGCTGCCACACAG
ACCGCAGCGGCTTCAGCGGCCCC
TGGACCAACGCGCCGACCACCTTCTCCAACCTGTACTTCCAGGAGCTGCTCAACAACAAGTG
GGTTGTCAAGAAGTGGGACGGGCCGCTGCAGTACGAGGACACCAAGAGCCAGAGCCTG
ATGATGCTGCCCTCTGACCTGGCGCTGCTCAGCGACCGCAGCTTCAAG
AAGTACGTGACCCAGTACGCCAAGGATGAGGAGGCGTTCTTCAAGGACTTTGCGGTGGCGTTCTCTAAGCTG
CTGGAGCTGGGCGTGCCCTTCCCCGCCAAGAGCGCGTGA

Retrieve as FASTA