Entry information : CreAPx04 (Cre16.g672950.t1.1)
Entry ID 8558
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2016-01-04 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-04 (Achraf Jemmat)
Peroxidase information: CreAPx04 (Cre16.g672950.t1.1)
Name (synonym) CreAPx04 (Cre16.g672950.t1.1)
Class Ascorbate peroxidase    [Orthogroup: APx019]
Taxonomy Eukaryota Viridiplantae Chlorophyta Chlorophyceae Chlamydomonadaceae Chlamydomonas
Organism Chlamydomonas reinhardtii    [TaxId: 3055 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CreAPx04
start..stop
S start..stop
VcaAPx02 144 4e-46 25..131 1..108
CsorAPx01 87 4e-23 3..131 1..134
CbraAPx01 59 0.00000000001 70..131 376..436
PmargAPx01 59 0.00000000001 80..131 357..408
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3487646..3487873 228 N° 2 3487393..3487476 84 N° 3 3486698..3486778 81  
complement(join(3486698..3486778,3487393..3487476,3487646..3487873))


exon

Literature and cross-references CreAPx04 (Cre16.g672950.t1.1)
DNA ref. Phytozome 11:   chromosome_16 (3487873..3486698)
EST ref. GenBank:   BE212303.1
Protein sequence: CreAPx04 (Cre16.g672950.t1.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   131
PWM (Da):   %s   14043.33 Transmb domain:   %s   i111-130o
PI (pH):   %s   10.72
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALRQAVRVPGAGLRMSAVAPVRPVRSVLARAEPPSGAKVTREYREDTGEVTAPGASQTTRRESDGLYVNADGPRPVPRKDNMSKEMKARLRQEYTGLGGAENKAMSNNYFLYISIFVAILAIMSKAIGAI

Retrieve as FASTA  
Remarks Complete sequence from genomic and ESTs. Incorrect prediction from phytozome (Only 3' end with gap in it). Atypical APx with only a small conserved domain
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCTTCGCCAAGCTGTGCGCGTGCCCGGCGCTGGGCTGCGCATGTCTGCTGTCGCCCCTGTGCGCCCTGTTCGCTCTGTGCTTGCTCGCGCGGAGCCTCCGTCGGGCGCCAAGGTG
ACTCGCGAGTACCGCGAGGACACAGGCGAGGTCACCGCGCCCGGCGCTTCGCAGACCACTCGTCGGGAGTCTGATGGCCTTTATGTGAACGCCGACGGACCCCGCCCG
GTAAGTTATTTG
CGCGGCGACCGAATGTGGGGCCCAGCTCAACCGGAAGTTTGTGTGTGGTTTTCAGCGACGCTGCCGGGTCGCACGTCAGCGCGCAGGCCGCCTCTTACTTCCAAACAGCGTACACATCTT
GTGAATACCAGCGCTCGTTTCAATTACCAATGCCTAGGTCCCCCGCAAGGACAACATGAGCAAGGAGATGAAGGCGCGCCTGCGCCAGGAGTACACCGGCCTGGGCGGCGCTGAGAACAA
G
GTGAGTGATGCGCGTACAGGGACTATCAAAACTTCCAGGAAGCGAGCGTCAGAGCGTGTGCAAGTCTGGTCGCGCGAGACGAAGTCGCACAGGCAGCGCTGTGTGGGGTACACGCGGGG
GGTACATGTCCGGCCTCCATACGCTGTCCGACCATGCTGGTGCAAACCCGCCTCCCAGGACAGTCGCGGCGTATACTTCTTTGTATAGGTGGCATGAGGGGTGCCCAAAAGCGTTCTGGT
TGTGGCAAGCCGCATTGGGGAAACTCGGAGTGGACAGGATGGGGCGTGCGCGCGAGGGGCTGGGTGTTCGGAACTGGCGTGTCGGGGCAGCCGGGCGAGCGAGTGCGTGTTTGTGTGCAT
CGGCAGTAGCAGCGGGGCCCCTGCGCAGTCGGCAGCAGGCAGCGTGTGCGCGGGGCAAGCGGGGGCCCCGCCGTCTGCGCCGCCGCCGCCCGCTCCTTTACGGGGTGTGTGAACGAGCTG
GACTGACGGCGGGTGCGCCTCCCCCTTGCCCCCTCCGCCCGCTGCCTGCTGCCGCCTGCTCTCCCCTCTGCCGCCGCATGCACCTCGCCTCGTCTCCTTCGGACTGCTGCGCTGGCGTGC
GGCTCTTGGGTTTAGGCCATGTCCAACAACTACTTCCTGTACATCAGCATCTTTGTTGCAATTCTTGCGATTATGTCCAAGGCCATTGGCGCCATC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCTTCGCCAAGCTGTGCGCGTGCCCGGCGCTGGGCTGCGCATGTCTGCTGTCGCCCCTGTGCGCCCTGTTCGCTCTGTGCTTGCTCGCGCGGAGCCTCCGTCGGGCGCCAAGGTG
ACTCGCGAGTACCGCGAGGACACAGGCGAGGTCACCGCGCCCGGCGCTTCGCAGACCACTCGTCGGGAGTCTGATGGCCTTTATGTGAACGCCGACGGACCCCGCCCG
GTCCCCCGCAAG
GACAACATGAGCAAGGAGATGAAGGCGCGCCTGCGCCAGGAGTACACCGGCCTGGGCGGCGCTGAGAACAAG
GCCATGTCCAACAACTACTTCCTGTACATCAGCATCTTTGTTGCAATT
CTTGCGATTATGTCCAAGGCCATTGGCGCCATC

Retrieve as FASTA