Entry information : VcaCcP01 (84225 / apx3)
Entry ID 8559
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2012-06-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-08-10 (Christophe Dunand)
Peroxidase information: VcaCcP01 (84225 / apx3)
Name (synonym) VcaCcP01 (84225 / apx3)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Viridiplantae Chlorophyta Chlorophyceae Volvocaceae Volvox
Organism Volvox carteri    [TaxId: 3067 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VcaCcP01
start..stop
S start..stop
VauCcP01 652 0 1..375 1..373
VgCcP 563 0 1..370 1..374
CreCcP01 535 0 1..369 1..369
CspCcP06 407 3e-143 64..366 1..295
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 93..269 177 N° 2 528..659 132 N° 3 1381..1553 173 N° 4 1772..1917 146
N° 5 2138..2226 89 N° 6 2586..2770 185 N° 7 3236..3341 106 N° 8 3670..3714 45
N° 9 3876..3956 81  
join(93..269,528..659,1381..1553,1772..1917,2138..2226,2586..2770,3236..3341,367 0..3714,3876..3956)


exon

Literature and cross-references VcaCcP01 (84225 / apx3)
Protein ref. UniProtKB:   D8UGR8
DNA ref. GenBank:   NW_003307623.1 (424792..420930)
Cluster/Prediction ref. UniGene:   Vca.8185
Protein sequence: VcaCcP01 (84225 / apx3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   378
PWM (Da):   %s   40338.32  
PI (pH):   %s   8.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSAPRMLRLGSLLARQAAPSSLLQQQFRTFSDNAAAEAAKAAPEAVKADSGSKGKIRGVQALIFGGLGAGMLYGYSLFTSQPPPSGPLAGPPTLPTGTAPKTSTPGDYAAVRDSISSLLEAADYDDGSYGPLLVRLAWHASGTYDKSSCTGGSNGATMRFPPECEWAANRGLAIARQLLEPVKAAHPWISYADLWTLAGVVAIEDMGGPSVAWRPGREDYSDGSKIVPDGRLPNATLGAKHLRDIFHRMGFDDRDIVALSGAHTLGRCHPDRSGFSGPWTNAPTTFSNLYFQELVNNKWRPKKWDGPLQYEDAKTGTLMMLPTDLALLSDRTFKKYVAQYAKDEEAFFKDFAVAFGKLLELGVPFPSAEKAAATS*

Retrieve as FASTA  
Remarks Complete sequence from genomic and ESTs. Strain="Eve".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACGTCGGCCCCACGCATGCTGCGGTTGGGATCGTTGCTTGCCCGGCAGGCGGCTCCCTCATCCCTTCTGCAGCAGCAGTTCCGGACGTTTTCCGACAATGCCGCTGCGGAGGCA
GCCAAAGCAGCTCCAGAGGCTGTTAAGGCAGACTCAGGGTCGAAGGGCAAGATTCGG
GTGCGTGAACTGACTATTCCGTGTCTCTGGATCATCAGGGGTGTTGCCAACGTGGCGAACTGC
CATGGCCATCTGGGAGTTGCCAGAGCGGAAAAACTCAGAAGGAATTGCCCTGCGGAATGATGTAAAATTGTAGGCTATTCTACAGGTCATTTCGATGGTCAAGCCAGTCATATGTCCTGT
CCAAAGTCCATCGGGTATCACTTGCTCGCCTTTGTTGACTGTCTCTCCCTCTTTTCCTTACACGACTATTTGCAGGGAGTCCAGGCGCTGATTTTTGGCGGTCTAGGCGCTGGCATGTTG
TACGGGTACTCGCTTTTCACGTCGCAGCCTCCTCCATCTGGACCCCTGGCCGGGCCTCCAACGCTGCCCACCGGGACTGCCCCGAAG
GTGAGGCCACTTGCTCTGTCGCCTTGGCCCTCA
CAGATCAGCATGGTCGGCGTCTGGCGATGTAGTTCTCGGTTCTCCTCCTGAAACACACTGTCGGAGCTTCTGCTGTTGGGTGCCGGATAGGCCTGTCGCGTCTGTGGCCAGTCTTCGAGA
GGTGGTCCAGGACAGACATTTTGCCAGATGCATGGCGGCCGGGATCAGGTTGGGATCGTTTGCTGATTGGGGGATCGTGCGACAGGCGCAGTGTTCTTCTATCTTTCATTTTGTATGGGG
CCGGTCTTAACACGACTTAACACACCGGTTGGTGGCACCGCGTCCCCTATCCCTGCCCGCCGATGCTCGCGCTGCCCAGCGAGCAGCTTTATTGGCAACAGCCACACGGCGCTGCCATCA
CAAGCCCCCACGCGCAACACATTTCGCGTCTGGGTGCTTTTCGCCCCTGTGCTCCTACCTCAACCAATCCTGTGCCCATGTTCCCATGAACACCCCCTTGCGCTCCCTCTCACGGTGTTG
ACTACACCGGGGGCATGCCAGCCACCAACACCAGCAACCCTTTCGTCCGCCACCTTCACTGATAGTACTAGGCCACCGCGGGCCAGTCCTTTGACCCTGACCATTCTGTTTTGTCTTCCT
CAGCCTTCACACCTTGCAGACTTGCCCGTGCGTTTCCTTCCTTAACTTGGTTGTTGCCAAATTTTCGCCTCGCATGTATTCCCCACAGACTTCGACTCCGGGTGACTACGCTGCGGTTCG
TGATTCCATCTCTTCCCTCCTAGAAGCTGCGGATTATGACGACGGTTCATACGGCCCGCTGCTGGTACGGCTTGCTTGGCACGCATCTGGCACGTACGACAAGAGTAGTTGCACCGGCGG
CTCCAACGGCGCGACCATGAG
GTGAGATGTCGGCTAACTTAAGGTGGGATGTGGTATGGTGTCGTACACGCACGTGGCATAGTGGACGTCTGTTACTGGAAGGGGCGTGAGGGCGAGCAC
GGAGGATGCATGAGCCTCTCGCGTGTATCTGAGTCCGGGAGTTGCCTGGTGGTTTTAGGCGGCATCAGTATCTGGATTGACATTCTCTGTTTGTACCTTCTCACCGTTTCTGATGACAGG
TTCCCTCCCGAATGCGAGTGGGCTGCCAATCGCGGTCTGGCCATTGCCCGCCAGCTGTTGGAGCCGGTGAAGGCGGCCCACCCCTGGATCAGCTACGCGGACTTGTGGACGCTGGCGGGA
GTAGTGGCCATCGAGGACATGGGGG
GTGAGGCGGGGTGGGGGACCGGGGGTGAGGCGGGGTGGGGGACCGGGGCCGGGGGAATTAGAAAATGTGGGGCATTGTTGGAGTGCATGTGGGTT
GCTCTTGGTGGGAGCGTACCATACCTGCTGTTGATTAGGTTAAGCCGTTCAAAAGCCGCCTCCTGACCCGACATCCAAAGCTCTATGCAACCCTTCCCAACCGCCCTCCATTCCCACTGC
TCCAGGTCCCTCGGTGGCATGGCGACCAGGCCGGGAGGACTACTCGGACGGATCCAAGATTGTGCCGGATGGCCGACTGCCGAATGCGACTCTGGTGCGTGGCGATCTCCCGAGGGGGTT
TAGAAAGGGGGGTTGCTGAGTCAGCGGCCGAGTCAGCAAGGAGTAGAACATTGTAAGGAGAGAAGGGGTAATCCGAGGGACAAGGTAATCTGAGGACGTCTGGGAACTCCCGCGGTGTAT
TTGTGTGCCGTACTGCTCCCCCGATGTGCACGGGATATGTGTACCTCGAGTTGGGGGATTCACATCGTCCGCCCTCGCTGCGCCGCAACTCCCTGTGACCTATCCCCCTCATTTGCCGGT
AGACTACGTTTCCGGGCTCATTTCCACCGCCTCGCGTTCCTGCTAACAGTCCTGCGCGCCCACTCAACTACTCGCTTCCCTCACCTCGGCCAGGGCGCCAAGCACCTCCGGGACATTTTC
CACCGCATGGGGTTTGACGACCGGGACATTGTGGCCCTCAGCGGGGCGCATACGCTGGGTCGCTGCCACCCGGACCGCAGCGGTTTCTCCGGGCCTTGGACCAACGCCCCCACCACCTTC
TCCAACCTGTACTTCCAGGAGCTCGTCAACAACAAATG
GTGAGAGGAGCGGGGGAGGGAAGAGGAAGGGTCGGATCTGGGCGGCAGAGTCAGGGGGGTTGGATTGGAACGCTATTAGTCA
GGAGGCGGGAGGCGCCGACATGGTTAGGGGCCCTCTAGAGGGTTCATAGAGGGGGAGGGGGCAGGGGGCTGTGGGAGCGGAAGATGGCCGTGGGGGGCTCATGACGCGAATGGACGCCCA
TGCACGTATTGATCGTCGCTGTTCACTTTGCACACGGCACAGCACGTTCATAAACGGTGCACTATACCCAATCATTATTATTGTTCCGGGCTGTTCCTAACTTGTACTGTAGTTGATACC
GCCTGTGTGCCGTTTTCAAGGATTCAACCGCCGCATGTATGTCTGATGACTTGCCGCACACCGCACCTCACTTGGGGTCCTCACCCAGCCTAACACGACCCGACCCGGGTCCGCCGCTGT
CCCCGATGTCTGTCTGCGTCCAGGCGCCCTAAGAAGTGGGACGGTCCTCTGCAGTACGAGGACGCCAAGACCGGCACCCTGATGATGCTGCCCACTGACCTGGCCTTGCTGTCGGACAGG
ACCTTCAAG
GTGCGGTTGCGGAGCGGGGGGCCTGGGGTTCGCTTTGTGATTTGGTGACTTACGTAACTGTAGTTCAGCTATGGAGCAGCACTTCGGTTGACGGCAGCAGCAGCAAATTGT
GTAATGTGAAGTCACAGCCATCAGTCCCTTTCCCGACCTCAGGCGGACACGGGGTACACGTGCTTAGATGTTGGCCGAGACTTTCTATTCGTAATTCCTGGTGTGATGTTTTTGAATCTA
GTTTCTGAATCTACGTTCGCTCGTTCGAAAGTCCACCCGTGTCCCGATGCTACTGACCCAGCGACCCGCTGACCCGCTGCCACCACCCGGAGTGCAGAAATACGTCGCTCAGTACGCCAA
GGATGAAGAGGCGTTTTTCAAG
GTACGCCCTCTTACACACAGCTGCTTAATCCCGTCTCGTGGTTTCCTCCCGGTTGGGTTCCTGACGAGCGACAGAAAGCAGTGCCACCATCATCATCG
TCGTCGTCATCGCATTTGGAAACACCTCTTGAATCCCTTTCTCCCCCATGGACTGCCCGCCAGGACTTTGCCGTGGCGTTTGGCAAGCTGCTGGAGCTGGGAGTACCGTTCCCTTCGGCG
GAGAAGGCGGCCGCCACGTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACGTCGGCCCCACGCATGCTGCGGTTGGGATCGTTGCTTGCCCGGCAGGCGGCTCCCTCATCCCTTCTGCAGCAGCAGTTCCGGACGTTTTCCGACAATGCCGCTGCGGAGGCA
GCCAAAGCAGCTCCAGAGGCTGTTAAGGCAGACTCAGGGTCGAAGGGCAAGATTCGG
GGAGTCCAGGCGCTGATTTTTGGCGGTCTAGGCGCTGGCATGTTGTACGGGTACTCGCTTTTC
ACGTCGCAGCCTCCTCCATCTGGACCCCTGGCCGGGCCTCCAACGCTGCCCACCGGGACTGCCCCGAAG
ACTTCGACTCCGGGTGACTACGCTGCGGTTCGTGATTCCATCTCTTCCCTC
CTAGAAGCTGCGGATTATGACGACGGTTCATACGGCCCGCTGCTGGTACGGCTTGCTTGGCACGCATCTGGCACGTACGACAAGAGTAGTTGCACCGGCGGCTCCAACGGCGCGACCATG
AG
GTTCCCTCCCGAATGCGAGTGGGCTGCCAATCGCGGTCTGGCCATTGCCCGCCAGCTGTTGGAGCCGGTGAAGGCGGCCCACCCCTGGATCAGCTACGCGGACTTGTGGACGCTGGCG
GGAGTAGTGGCCATCGAGGACATGGGGG
GTCCCTCGGTGGCATGGCGACCAGGCCGGGAGGACTACTCGGACGGATCCAAGATTGTGCCGGATGGCCGACTGCCGAATGCGACTCTGGGC
GCCAAGCACCTCCGGGACATTTTCCACCGCATGGGGTTTGACGACCGGGACATTGTGGCCCTCAGCGGGGCGCATACGCTGGGTCGCTGCCACCCGGACCGCAGCGGTTTCTCCGGGCCT
TGGACCAACGCCCCCACCACCTTCTCCAACCTGTACTTCCAGGAGCTCGTCAACAACAAATG
GCGCCCTAAGAAGTGGGACGGTCCTCTGCAGTACGAGGACGCCAAGACCGGCACCCTG
ATGATGCTGCCCACTGACCTGGCCTTGCTGTCGGACAGGACCTTCAAG
AAATACGTCGCTCAGTACGCCAAGGATGAAGAGGCGTTTTTCAAGGACTTTGCCGTGGCGTTTGGCAAGCTG
CTGGAGCTGGGAGTACCGTTCCCTTCGGCGGAGAAGGCGGCCGCCACGTCTTAG

Retrieve as FASTA