Entry information : VcaAPx01 (105827)
Entry ID 8560
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-09-27 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-11-29 (Qiang Li)
Peroxidase information: VcaAPx01 (105827)
Name (synonym) VcaAPx01 (105827)
Class Ascorbate peroxidase    [Orthogroup: APx004]
Taxonomy Eukaryota Viridiplantae Chlorophyta Chlorophyceae Volvocaceae Volvox
Organism Volvox carteri    [TaxId: 3067 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VcaAPx01
start..stop
S start..stop
CreAPx01 393 2e-137 3..360 2..347
OCgAPx01 246 1e-80 77..351 1..270
AacAPx01 179 8e-55 74..296 28..245
McalAPx05 141 1e-39 111..351 89..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 798960..799107 148 N° 2 799440..799600 161 N° 3 800189..800301 113 N° 4 800613..800673 61
N° 5 801149..801232 84 N° 6 801565..801750 186 N° 7 802116..802343 228 N° 8 802774..802875 102
join(798960..799107,799440..799600,800189..800301,800613..800673,801149..801232, 801565..801750,802116..802343,802774..802875)


exon

Literature and cross-references VcaAPx01 (105827)
DNA ref. Phytozome 12:   scaffold_34 (798960..802875)
Protein sequence: VcaAPx01 (105827)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361
PWM (Da):   %s   37736.93  
PI (pH):   %s   9.54
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRHVAFKSAGSHRRCAAPAKAGSSRARAAVVVCSLAREQVLGRRQLLGTGAVVLAAGTTPLLIPQPVVAGPLPQALVPVDQLGLLQKQAQLKDFRLRAEAAIKEVLGAADASACMRLVLHDAATYDAATKTGGLDGSIVLPEELSRPENAGLDVIVDKLAQAKAKIDAGGAEDGSGPISWADLIVLAAKVTTQAQWASIKRSRAQIASGGDVIAGPAFGAAWPVRLGRTDSTVPGPAGRIPSADASVGDIKSFMEKLGVAPGSNVGSGLFSAKPPFWERPTLVLWTAAAADPAAEEERFVAQDPAAFKGYKQNYDRSRKTVTRTDYEVDFIDYFTLLTNLGASFKKDAYLHPEAVVAVKF*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCACGTAGCGTTCAAATCTGCGGGGTCTCATCGTCGGTGTGCTGCTCCTGCAAAGGCTGGCAGCAGCCGTGCTCGTGCGGCAGTGGTGGTTTGCAGCCTCGCACGCGAACAGGTC
CTTGGCAGGCGTCAACTCCTGGGCACAG
GTGACAACCTATGATGCTTTCGTGGTTGCTTCCTAAAATTGCGATAGATCCTTATGGTGCAATGCTCCTCGGCTTGCGAGATGCCAGCAATT
GTCGCTGTCCTACACTTTCATGATCAGTTGGCGTTTGAAAGCCACAGAAATTTTGCGCGTTACCTTTACAGGCGGCTTTAGTCACGTTGTGATTTCCTTGAATTTGTCTTTATTTGGGAG
ATTGTTTGTGGCTGGATGGCGCAGCATCCCCAACCTAACGCTCCAATCGCAACAACTGACGCCAACCGCCCAAACGGTCCTCTTGGCCCTCTTCTCCCGTCTTCGCCCCATGTGCACCAG

GCGCTGTTGTTCTGGCTGCCGGTACAACTCCGCTCCTGATTCCTCAGCCCGTTGTCGCGGGTCCGCTGCCACAGGCGCTTGTGCCGGTGGACCAGCTTGGGCTGCTGCAGAAGCAGGCCC
AACTCAAAGACTTCCGCTTGCGGGCTGAGGCCGCGATCAAG
GTTAGATCAAATTCGGCATGCATCTCTCCATAGTTGCAATCAATCACAGCATCCTTTTCATGGCGACGGTCTTTCTTTA
ATGTTGAAGAGCAGTGTTAGTGGAACACTTGATCGCCTGCAACTTGACGGTTTGGGTTTTCGGCTCGCGTTCTCAATCACACTCCAAGTTTGGCATCGCTGGCCCCGCCCACCGGCTTTT
ACACTCCTGCTCGGGGTACAATGTGGTAAAGGCGCCTGTCAATGATGGAAGTGTTAAAATAACAGGGACAGAAGAATGCCCGCAGACGCAAGCACATGTTTAATGCATACTCAACATTTC
CGCACCTAGTTGACATCTTGGGTTGCCACATATTACCCTTGCCCCGGTACCCGTGTCAGTTCATGCTGTCTGCCCCGCAGGGTATCTCCTCAAATCTCACTTGAGACTCACAAAATCCGG
ACACTCCCTAAACCCAGGGAGTTGCCCACATCTTTTTGCACACTGTGCACCGGAAAAGCTATGGATGTTGCCTTTTTCGCTGTTTTCCATGCGGCAAACATCCTGATTGTGCATTAATGA
CCTTCCTCGAAACGAACCGATCCTTGCAGGAGGTACTGGGTGCAGCTGATGCGTCGGCATGTATGCGCCTCGTATTGCACGACGCTGCCACGTATGATGCGGCAACTAAGACTGGTGGCC
TGGACGGCTCGATTGTGCTGCC
GTAAGTGTCATACGTGGCCACCAGCTATGTTTGAGCAGCCGTGCTTTTGCACTGAGAACATGCGCACATTCGCTGCGCCTTTCGAATGCAATTGCTGT
CACAAGGAGAGATGGAAAGGGTGGCTTTGGTCCATCTATCCTCGGAATATCGGTTGTGCGTTGGCTTTGCGAGGCTCTTAGGTGCTGCAACGAAATTTCCCCTGTTTTAATCCCAACTGC
AGTTACGTTCGCATTCGTTTAATGTTTCAGTTCGTTCGCCTCAATTCTCCCGGACTTGCGTGTTCATGAACCTCGCCTTGGCTTCCATTTCAGGGAGGAGCTGTCTCGCCCGGAGAACGC
TGGGCTGGATGTGATTGTGGACAAGCTGGCGCAG
GTAGGATGGGCGACCGGGCTGCTTGCTTTGACTGGCCTAGTTGTTGCCAGTAGAGCTCGTGCTGATCACGTGCTCTTCCTGGCAAA
TGAGATTTGGGGACAGCCGACTCGACCTAAACTACAGGAGCTCACACTACATGCATTTTTTCTTGACCCCATAAAGCCTTGAGGCCACGAAGAGGCTATGAAATCAGGCGCTGGGCAATG
TCTGATATTGGTGGTGACGTAGGTCTTATATATTGTTGGCAAGGAGCTGAGGGGCAGACAATTCCGGCGGAAATGCTCATCGACGATGTTCAGGAAACCTCCTTGCGTCACCATGAAAAC
TACCCATATCCCAGCCCTCACACGCGCATGCAATACTCCTGCGTCTCCTGTTAGCCCGTGTAATTTGAATGTACCATGGCTGAAGAGTGCTCTGCACTTGTGCAACGTCACCCTTCAATG
GCCCCAACAACCGTACTGTACTGCCGCAGGCCAAGGCGAAGATTGACGCTGGGGGTGCTGAGGACGGCTCCGGACCCATCAGCTGGGCTGATCTGATTGTGCTGGCGGCCAAGGTAGGTG
TTGTCATTGTGTGGAAGGATGGGAATTCGTGCAACAGCCAAAAAAAGCTGCGTCCCGCAAGAGTTCAGCATCAGGGAATTGCAGGTGGGCGGTTGAAGTATGAAAACTTAGGACCAAGAT
GAGTGAAACAGCCCTTGATGGCGCATGAGACGTGTCCTGAAAGGGGCTAACAAGGACTCGCTGGCGCACTTGATGATGAGATGGATGTGCAACCTACTCAGTCTATGCAGTGCATACGCA
GTTCCAAGTTCCACACTACAGCAGGGCGCATCCACACTCCGTAATCCTCCTTACACCCTCGAAATCCATGCCTCTACCTCAACAGGTGACCACCCAGGCACAGTGGGCCTCAATCAAGCG
CTCCCGCGCCCAGATTGCCAGCGGTGGTGACGTCATCGCTGGGCCCGCATTTGGCGCCGCGTGGCCGGTGCGCCTGGGTCGCACGGATTCCACTGTACCGGGCCCCGCGGGCCGCATCCC
GTCCGCGGACGCGTCCGTGGGTGATATCAAG
GTACAGAAACAATTGAGATTTGCTGCCCTCCTAGCGCATTTCGTGGAATTTAACCCTGACCCTGTCTGGCTCTGGCTTGGCTCAGTTAC
CTGTTTGCGGCTGACACAGCCGGTTGGCAGGACCCAATTCATCTGCGGCTCATCCAGAAGGATGTCTATTCACTGCATCACCAACGAACGCCTCTCGCGCGCGCATTCATTTAAGACTAT
CGGATATAGCTTGATTGAGATAACGTAAGCCATCTGATAAGAATAAGAGAGGCCGTTCTGGCTGGACATAGCAGTAACCTCAGCCCGTCCAAACTGATTTTACTTGGCCGGACATGTCAT
CAATCCAATCTGCCCTAAATCCATTCCATATGCCAGAGCTTTATGGAGAAGCTTGGTGTGGCGCCAGGCTCCAATGTGGGCAGCGGTCTCTTCTCCGCCAAGCCGCCGTTCTGGGAGCGT
CCCACGCTGGTGTTGTGGACTGCTGCTGCCGCCGACCCGGCGGCTGAGGAGGAGCGCTTCGTTGCACAGGACCCGGCGGCGTTCAAGGGCTATAAGCAGAACTACGACCGCTCGCGGAAG
ACAGTTACGCGGACGGACTACGAG
GTAATTGCTGGTGCAGGGGGACTTGGCTGTCGGTATGTGAGATGGATATTATGGGCATGATTATCGTAGCCGTGTGGCAATGCTGGCATGCCGCAC
CGTCTGCAGCAATCAACTGGGCAGACAGCAGCGAAGAGATAAGATGGAAAGCAGTCGGGCGTTCGACAGTGCAGCTGGATTGGTCGGTGTGGGTTGCAGAATGCGTAGCCGTCGTCGTTT
CATGAATTAGGCCAAAGGTTTTCGGCAGGTGACCTCGTGCGGCATGATCATTCCACAGTGTACCCCGACGGCGACGGTGGCGAATGCTGACAGCCTGGTATCTGGCCGTTGCACCCGTTG
ATGGCTTTGGACGCATCCCCATTGGCTTGTCGCACATGCATGTTGCCAGGATATTTTCCGGTAATGTATTTCGCCCTGTTGCTTACGTTTGTAGGTTGATTTCATCGACTACTTCACGCT
GCTGACCAACTTGGGAGCCTCTTTCAAGAAGGATGCTTACTTGCACCCGGAGGCTGTGGTGGCCGTGAAGTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCACGTAGCGTTCAAATCTGCGGGGTCTCATCGTCGGTGTGCTGCTCCTGCAAAGGCTGGCAGCAGCCGTGCTCGTGCGGCAGTGGTGGTTTGCAGCCTCGCACGCGAACAGGTC
CTTGGCAGGCGTCAACTCCTGGGCACAG
GCGCTGTTGTTCTGGCTGCCGGTACAACTCCGCTCCTGATTCCTCAGCCCGTTGTCGCGGGTCCGCTGCCACAGGCGCTTGTGCCGGTGGAC
CAGCTTGGGCTGCTGCAGAAGCAGGCCCAACTCAAAGACTTCCGCTTGCGGGCTGAGGCCGCGATCAAG
GAGGTACTGGGTGCAGCTGATGCGTCGGCATGTATGCGCCTCGTATTGCAC
GACGCTGCCACGTATGATGCGGCAACTAAGACTGGTGGCCTGGACGGCTCGATTGTGCTGCC
GGAGGAGCTGTCTCGCCCGGAGAACGCTGGGCTGGATGTGATTGTGGACAAGCTGGCG
CAG
GCCAAGGCGAAGATTGACGCTGGGGGTGCTGAGGACGGCTCCGGACCCATCAGCTGGGCTGATCTGATTGTGCTGGCGGCCAAGGTGACCACCCAGGCACAGTGGGCCTCAATCAAG
CGCTCCCGCGCCCAGATTGCCAGCGGTGGTGACGTCATCGCTGGGCCCGCATTTGGCGCCGCGTGGCCGGTGCGCCTGGGTCGCACGGATTCCACTGTACCGGGCCCCGCGGGCCGCATC
CCGTCCGCGGACGCGTCCGTGGGTGATATCAAG
AGCTTTATGGAGAAGCTTGGTGTGGCGCCAGGCTCCAATGTGGGCAGCGGTCTCTTCTCCGCCAAGCCGCCGTTCTGGGAGCGTCCC
ACGCTGGTGTTGTGGACTGCTGCTGCCGCCGACCCGGCGGCTGAGGAGGAGCGCTTCGTTGCACAGGACCCGGCGGCGTTCAAGGGCTATAAGCAGAACTACGACCGCTCGCGGAAGACA
GTTACGCGGACGGACTACGAG
GTTGATTTCATCGACTACTTCACGCTGCTGACCAACTTGGGAGCCTCTTTCAAGAAGGATGCTTACTTGCACCCGGAGGCTGTGGTGGCCGTGAAGTTC
TAA

Retrieve as FASTA