Entry information : VcaAPx02 (74218)
Entry ID 8561
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-09-27 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2011-11-29 (Qiang Li)
Peroxidase information: VcaAPx02 (74218)
Name (synonym) VcaAPx02 (74218)
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Chlorophyta Chlorophyceae Volvocaceae Volvox
Organism Volvox carteri    [TaxId: 3067 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VcaAPx02
start..stop
S start..stop
CreAPx04 144 3e-46 1..108 25..131
CsorAPx01 84 3e-22 19..108 37..134
CmichAPx17 53 0.00000000003 60..106 3..49
TaAPx01-1D 57 0.00000000003 56..106 313..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 982588..982746 159 N° 2 982908..982991 84 N° 3 983972..984055 84  
join(982588..982746,982908..982991,983972..984055)


exon

Literature and cross-references VcaAPx02 (74218)
DNA ref. Phytozome 12:   scaffold_14 (982588..984055)
Protein sequence: VcaAPx02 (74218)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   108
PWM (Da):   %s   11744.13 Transmb domain:   %s   i88-107o
PI (pH):   %s   9.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLVLTRADPPSSGARVTREFREGDSEVTIPGAPSNVSKQADGLYVDVNEPPRRPKTDNMSKEMKARLRAEYTGLGGAENKAMSSNYFLWISIIVALLAISSKLIGAI*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Just short 3' end).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCCTCGTGTTGACCCGTGCTGACCCTCCGTCGAGTGGAGCTCGTGTTACGCGCGAGTTTAGGGAAGGAGACTCCGAGGTCACTATTCCTGGCGCTCCGTCCAACGTCTCTAAACAG
GCTGATGGCTTATACGTCGATGTGAATGAGCCCCCCCGG
GTAAGTCATTTTTACGTCGTGCGGTGATGAGTCGTCTGTCGACACAGCAGGTTGTGTGGCTTGCACAAGTCGAGCGCGGGG
AAATGTCAAGGAGCCTTGACAACCCTTGAATTTGCATTGATATTTATTTTAATCCCTTCAATGCATGTTTTGTAATTCAGCGCCCTAAGACGGACAACATGAGCAAGGAGATGAAGGCCC
GGCTGCGTGCGGAGTACACTGGCCTAGGCGGAGCAGAGAACAAG
GTAAGCAAAGTCTTACTCACTTCAGAATTCAAGCAGCGAGAGGCTAGGTAGCATACCGTTTGCTTGAAGAAGGCTT
AGGGACCAGAACCGCGCAACCGTCAAGGGGTGCATGCAAACGTTCAATGTAACTGGCTTCTAAAGAAGCGTTTTGCAACTACGCAAACAATAATTTCTTATTGGAATGTTGAGCCGACAA
TAGCAGGAGCCCTTTGCTTGATGGAAGACGTACCAGGGAGAGCAAAGGTCGTTGTCCTGGTTGTCCGCGGTCGTCCAGTGCCCCGCTCGTTGTTCAGGCCTGATGGGTCCAGGCCCAAGC
TCTTCCTTCCTCAAGCTCTTAACTCTTTCAGAGCTTACATGCCTAATCCCTCATTCCGTCAGACAGCGTGAAGCTGCCTGACGGAGTCAGGGATTAGGCAACTGCAATCTATCTCTTTCC
TTCCTCTTCCCCTCTTTTGTCTCTCCATTAGTGTTCGGTTGTCCTTCTATTAGCGCTCAGTAGGCTGTCGTCTTCGCGCTACAAGCTTATTCCACTCCCTTACTAAATAGCCAGCACGTT
AACTAACCGAAGCCCGAAAACAATAACAATTGCTTTCAGAGCATGGATGTGTCAGAAGCCGTGCAAGTAGGCTGTCTCGGTCCATCTCCGTGCGCGGGCATGATGCGGTGCGGGGAAGAC
GCGGTCCATCAGATTTTTCTGGCGTTCCGCGCGCTTTAATCGTGTTGGGAAGGAAAAGTCTCTCGGGAAGGGGCGTTGATGGCGGGAGAGGGAGGACGTGGGAGCGGGGAAAGGAGGAGA
GCACGGGCTCGCACGCGCTNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTCCGTATGCCCCCCTCTCGTATCGCCAATATGCGTGCGGGGCGGTTCTAAGACGACGGGCCCCCNNNNNNNN
NNNNNNNNNNNNNNNNNCTCCGCCCCCTCCCTCCCCCCTTCGGCTCTCCTTGCTCCCGCCTCAGGCGATGTCCTCCAACTACTTCTTGTGGATCTCGATTATTGTGGCGTTGCTGGCTAT
CAGCTCCAAGTTGATCGGCGCCATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCCTCGTGTTGACCCGTGCTGACCCTCCGTCGAGTGGAGCTCGTGTTACGCGCGAGTTTAGGGAAGGAGACTCCGAGGTCACTATTCCTGGCGCTCCGTCCAACGTCTCTAAACAG
GCTGATGGCTTATACGTCGATGTGAATGAGCCCCCCCGG
CGCCCTAAGACGGACAACATGAGCAAGGAGATGAAGGCCCGGCTGCGTGCGGAGTACACTGGCCTAGGCGGAGCAGAGAAC
AAG
GCGATGTCCTCCAACTACTTCTTGTGGATCTCGATTATTGTGGCGTTGCTGGCTATCAGCTCCAAGTTGATCGGCGCCATCTGA

Retrieve as FASTA