Entry information : VcaAPx03 (82395)
Entry ID 8562
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2015-12-16 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-16 (Achraf Jemmat)
Peroxidase information: VcaAPx03 (82395)
Name (synonym) VcaAPx03 (82395)
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Viridiplantae Chlorophyta Chlorophyceae Volvocaceae Volvox
Organism Volvox carteri    [TaxId: 3067 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VcaAPx03
start..stop
S start..stop
CreAPx02 526 0 10..326 9..326
RobtAPx04 376 2e-131 29..319 1..266
SsAPx04_AU1 378 5e-131 29..319 79..344
NhyAPx05 375 6e-129 33..326 123..391
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 590452..590658 207 N° 2 590741..590822 82 N° 3 591454..591527 74 N° 4 592084..592113 30
N° 5 592334..592421 88 N° 6 592844..592993 150 N° 7 593798..593955 158 N° 8 594359..594435 77
N° 9 594736..594853 118  
join(590452..590658,590741..590822,591454..591527,592084..592113,592334..592421, 592844..592993,593798..593955,594359..594435,594736..594853)


exon

Literature and cross-references VcaAPx03 (82395)
DNA ref. Phytozome 11:   scaffold_37 (590452..594853)
EST ref. GenBank:   FD837211.1 [5' end]
Protein sequence: VcaAPx03 (82395)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   35279.75  
PI (pH):   %s   8.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQTCFPKGTTKRAFVGSCRRRTPTVCVRAAVNVEQLKALRQELFSYINSRGCNPIIVRLGWHDSGTYDKNIAEWPARGGATGSIRFKPEIDHAANKGLAIALGILGPMKKKFPEVSYADLFQMASAVAVEAAGGPKIPMRYGRKDATSPEQCVPDGRLPGAAHPFADGSTSPAEHLRRVFGRMGLTDQEIVVLSGGHTLGRARPERSGFGADKTKYTDVGPGTSSASPSGSPDRPVTPKPVGQLGTSWTANWLEFDNSYFTVKAKRDADLLVLPTDACLFEDDGFRWPYAEKYAADQEAFFADYALAQQKLSELGVEWDEGAPVT

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns) and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGACCTGCTTCCCGAAGGGCACAACTAAACGGGCTTTCGTCGGCTCATGCCGTCGAAGGACTCCTACGGTGTGCGTTCGTGCGGCTGTCAACGTCGAGCAACTTAAAGCTCTCCGG
CAGGAGCTGTTCAGCTACATCAACAGTCGTGGCTGCAACCCCATCATCGTCCGCCTTGGTTGGCATGACAGCGGCACCTACGACAAG
GTATGAATGAATTTGGCTTATTTGGGCGTGCTC
TCGCGAAGCAAACCGAGCTTCCATTTTGCGGGATGTCGCCATGCTGCAGAACATCGCCGAATGGCCCGCTCGCGGGGGTGCAACTGGTTCCATTCGCTTCAAACCGGAGATCGATCATGC
TGCGAATAAGG
GTAAGCCATGAGGGTTGCATCTCGGTTGGATGCTTGCAACTGGGACGCAAGCAAATGCTGGACTATTTGATTCGGCAATTGGCCTCAGGTTGATTGACTGGCGGCGGTG
AAAGCCAGCGTTTGCATCGCGGGGACGACTGTATCCATCCGATCAATTGTGGAAGTGTCGGAGGTTAAATTTTAGGAGAAATTCTCGGCTGCATTTGACCATACGATAGCTCGCGGATAA
TGTATCATTACATCTTACGATTTCTTGCGTGTGTTTAGGCTCCTGATCGACTGCCTGGATGTTGGTCAGTGTCGGCCCAGAAGCGTCCGCAACGTACTGCGCTCATACCTGAAGTAAATG
GATTTTTGCCTTGGGGTTCACCTAGATCATGTGCCTCCATAAAATTTTCCTTCGCGGAAGAGGTTAACGACGACCAACCGCGACATGGCAAAATGGGATGCTATACTTGCTCAACCTGGC
ATTTCCATATGGCTTAACACAGCTTAGACAATGATACCTTCCTTTACAGAGAGTAATATCGTATGGAGATCATTTGATGACATGTCGTCCGCAGCTTGGAGAACCTTTTCGTCTTTCCAA
CCCTTTTGGCCCCGATGCTCTGCCGTTGACAATCTTTCCCAGGCCTAGCCATCGCACTGGGCATCCTGGGACCCATGAAGAAGAAGTTCCCCGAAGTGTCCTACGCTGACCTGGTACGGC
AGGGAAGGGTCTGAGACTTGGGCGAAGGGGGCATCCGGAATAACCCGGAGTGCGGAATCTCAGAATGACGCAGCTCGACCCACAATTTCAGTAGTCCTCCATGTCCCATAAAATCATTCA
GATGCAACTCAGCATAGCGAAGCACTCCCATATCTTCACATCAGCTCCCAATCAGATCCCGGCAGTTAAACTCACCAGGTTCCAGGCGTAATTGTTGCGCCGGGTGCTTACCCGAATGGC
GGGGCTCAATCCTTCCTTGGCTCCAACCGCTGTTTTCCAGAACCCGGCTTTGTTTCCCAACTACTCCTTGTTAAGAGCCAGATCGTGCTGTATGTTTGATCTATCAGCGCCCTACCTTTT
CTCCATGAGAAAGGTTGGTTCTCCTCCAGCCCGGTGTGAACGTTTTTTCCATCCCCATGTGAAAGGGCGTTTAGGACGAACTCCTCTTCAAAGGCTCAACGTCCCTCCCTCCCCGCTTCC
CCTCTTCCCGCCCTTCCCCTTGCTTGTCCCTTGGCTCATTTGCCGGGTCGTGTTCACCGCGGTGCGGTGCAGTTCCAAATGGCCTCTGCGGTGGCTGTGGAGGTGAGCGGATGGGGGCAA
GGGCAGGGTAATGAGTGTGCGCACATTTGCGCTTGCGTAATGGCCTACGTGTGCGTGTTATGTGTGCGTGATCTCTTCCAGGTTCCACCTCTTTCTTTCTTCGCTCCTTGTACCTGCCCT
TTCCGTCGTCCCTCACCCTCCCTCCTGGCAATCACGTCCTTTTCCTTGTCTCTCCCTGTACCTGCTCTTCGCCCCTTGCCAGGCAGCTGGAGGTCCCAAGATTCCAATGCGCTATGGCCG
CAAGGACGCCACCAGCCCCGAGCAGTGTGTACCGGATGGCCGCCTGCCTG
GTGGGCCTGGGGGCCTTGGGGTTGTTAGGAGGCCGGGAACCCCCCATCATCAAAGGTCGAATTGGGAATT
GAGACATTAGAAAGACCGTGGCCGAGAACCGACCCACGGGTCAACGATTTAAGTTCGTGGGGGAAGTACGAGTGGCTCCAGGCCACTAGCCCTGAATCTCTGGCCGTGTTTATCCTTTCC
TGACCCACCCCCATTTATCGTTCCCACCCTTCCACCTGCCTCTCACCACCCTTCCCTCAGCTTTAGGGGAAACTGTGCAGCGGATTAGTAATGCATCTTGATTTCCTCCCCCTAACCCCC
CTGGGCCCTTCGAGGGAACCGAGGTCCCTACCCATACCAGGATGACATGTCCTTGCCCACGCACTCGAGTGGCCCGTCCCGCCCTCCCGTCCTGCCCGGGGTCGACACGCAGGCGCCGCG
CACCCGTTCGCGGATGGCAGCACCAGTCCGGCGGAGCATCTCCGACGAGTGTTCGGCCGCATGGGGCTCACCGACCAGGAGATCGTGGTGCTGAGCGGGGGGCACACGCTGGGCAGGGCC
CGACCTGAGCGCTCCGGCTTCG
GTGAGGCCGCGTCCGTGTGTATTGTGTTATGCGTATTGTGGGTCAAAACGGAAAGGAAATCCCACCATGCGAATCATAAGTCTGTGCGTATGTATGTA
TGGGGGCGAGCCCTGTGGCTTGCTTCAAGGGAAGGCCGGGGGGAATGGGGCCTGAGTTTGTACGACGCGGCGGCACGCCAGGTTAGGCGTATGGAATGCGGCGATGAGCACCATGCATCA
GCAAAACCCACGACGTCAACTTGTCACGTTGTCGCAGCACGCGCACGGTGCTATGGCGGTGTCCACCAGTGGAGCCAGCGGCGCGTCCACCTCCCCGTATCCTCCTCGGCCCGTATTGGG
CCCTAGACCATTTTTACCCCTAATTTTTCTTGCATCGTCAGCCCCCACGCCGCATGCCCCCAGCCAGGGCCTTGGCCCATCAGTTGACAGCAGCCGCGGCTCTCCCGCATCTCTCCCCTC
TCTCCTGTGTTGCCCTTGTTCACTATGTATAGCTTGCGTGACCTTGCTTGACATGACATGACATAACATAACCTAAACCATCACGCCCTTACGTCTATTCCGGCTATGCCAATTTCTTTT
GCATCACCGCTGCAAACGGGTCGCTTGAATAACATTTACAATAACCTTTCACCCTTTCATCTTATGACGACTTATCATCATCTCACCGTTTCCCGAACGATGTGACACCGCCTTCTTTTA
AAAATTTCTACACCCTGTTTCACACCATACCCTGTTACATGTTGGGAGCTATTTATTAAAAGCTCGTGACCGGTCCCTGTAAACTCCGATAAAACCTTCTTCGCAGGTGCTGATAAGACC
AAGTACACCGATGTGGGTCCCGGCACGTCGTCCGCCTCGCCATCAGGTTCCCCCGACCGGCCCGTCACACCCAAGCCGGTGGGCCAGCTGGGGACCAGCTGGACAGCCAACTGGCTGGAG
TTCGACAACAGCTACTTCACAGAG
GTACGTCGTGTGTGGGAAAAAGGGGGGAAAGTCCTCGTTGGCGGCAGGGAAGGGTTGGGAGGTAAGGAGAGAACGAAGACGGGTGCTGGGGAGAGC
GGGTGTTGTACAGAGCTGGGTTGTAAGCGACGGGGGGAGTTAGGGGCTTCAGGAGGGACGAGGCATTCAGTCCCTTATGGTTCCGGGGCGAGCCGTGGTTAGAGCTTCGGAAGGCTTCGT
CGTAAGGAGGGGGTTGGACATGGCCGCCCCTTTGTTGTGGTGTGTCTCGCATGGTCTGACGATTCCACCAACATCATCCTCTGTTCTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNATATAAGCTTAGTTAATGCTGCCACTGCTATGGCCACCGCGTTGTTCGGTTGCAGGTCAAGGCCAAGCGGGATGCGGACCTGTTGGTGCTGCCAACGGATGCCTGCCT
GTTCGAGGATGACGGGTTCAGGTG
GGAAGGCTGGGAGGCGTACATGAATTAGGGCGGGAACGGGTCGGGACTGTAGTGCGGAGGACTCTGCTGTGATGGGTCCAAATCTCCTGTGCCAAT
CAATTGGCTCACCGCCGTTGAATCCGGTTTAGCGTCCTGAGTTTTTACCTTTCTTCGCCCTTCACACGCTTATCAGGTACCTGCCGCCCCGGGCCCCATTTCCATGCCCCATACTTTACC
TGTCCCTGCTGCCCCTACCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACGTCTCCCCACAGGCCATATGCTGAGAAGTACGCTGCTGACCAGGAGGC
GTTCTTCGCAGACTACGCCCTGGCCCAGCAGAAGCTGTCGGAGCTCGGGGTAGAGTGGGATGAGGGAGCGCCAGTCACCATC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGACCTGCTTCCCGAAGGGCACAACTAAACGGGCTTTCGTCGGCTCATGCCGTCGAAGGACTCCTACGGTGTGCGTTCGTGCGGCTGTCAACGTCGAGCAACTTAAAGCTCTCCGG
CAGGAGCTGTTCAGCTACATCAACAGTCGTGGCTGCAACCCCATCATCGTCCGCCTTGGTTGGCATGACAGCGGCACCTACGACAAG
AACATCGCCGAATGGCCCGCTCGCGGGGGTGCA
ACTGGTTCCATTCGCTTCAAACCGGAGATCGATCATGCTGCGAATAAGG
GCCTAGCCATCGCACTGGGCATCCTGGGACCCATGAAGAAGAAGTTCCCCGAAGTGTCCTACGCTGACCTG
GTA
TTCCAAATGGCCTCTGCGGTGGCTGTGGAGGCAGCTGGAGGTCCCAAGATTCCAATGCGCTATGGCCGCAAGGACGCCACCAGCCCCGAGCAGTGTGTACCGGATGGCCGCCTGCCT
G
GCGCCGCGCACCCGTTCGCGGATGGCAGCACCAGTCCGGCGGAGCATCTCCGACGAGTGTTCGGCCGCATGGGGCTCACCGACCAGGAGATCGTGGTGCTGAGCGGGGGGCACACGCTG
GGCAGGGCCCGACCTGAGCGCTCCGGCTTCG
GTGCTGATAAGACCAAGTACACCGATGTGGGTCCCGGCACGTCGTCCGCCTCGCCATCAGGTTCCCCCGACCGGCCCGTCACACCCAAG
CCGGTGGGCCAGCTGGGGACCAGCTGGACAGCCAACTGGCTGGAGTTCGACAACAGCTACTTCACAGAG
GTCAAGGCCAAGCGGGATGCGGACCTGTTGGTGCTGCCAACGGATGCCTGC
CTGTTCGAGGATGACGGGTTCAGGTG
GCCATATGCTGAGAAGTACGCTGCTGACCAGGAGGCGTTCTTCGCAGACTACGCCCTGGCCCAGCAGAAGCTGTCGGAGCTCGGGGTAGAGTGG
GATGAGGGAGCGCCAGTCACCATC

Retrieve as FASTA